Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | ACAM22_RS00020 | Genome accession | NZ_AP028929 |
| Coordinates | 1372..1497 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799683.1 | Uniprot ID | - |
| Organism | Streptococcus sp. SN-1 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1..6497
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACAM22_RS00010 (MASAN616_00010) | rlmH | 611..1090 (+) | 480 | WP_000695936.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACAM22_RS00020 (MASAN616_00020) | comC | 1372..1497 (+) | 126 | WP_000799683.1 | competence-stimulating peptide ComC | Regulator |
| ACAM22_RS00025 (MASAN616_00030) | comD/comD2 | 1518..2843 (+) | 1326 | WP_023944979.1 | competence system sensor histidine kinase ComD | Regulator |
| ACAM22_RS00030 (MASAN616_00040) | comE | 2840..3592 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| ACAM22_RS00045 (MASAN616_00050) | - | 3842..5098 (-) | 1257 | WP_265471657.1 | ISL3 family transposase | - |
| ACAM22_RS00050 (MASAN616_00060) | - | 5257..5799 (-) | 543 | WP_265471656.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4916.95 Da Isoelectric Point: 10.7877
>NTDB_id=107295 ACAM22_RS00020 WP_000799683.1 1372..1497(+) (comC) [Streptococcus sp. SN-1]
MKNTVKLEQFVALKEKDLQEIKGGEMRLPKILRDFIFPRKK
MKNTVKLEQFVALKEKDLQEIKGGEMRLPKILRDFIFPRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=107295 ACAM22_RS00020 WP_000799683.1 1372..1497(+) (comC) [Streptococcus sp. SN-1]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTAAAGGTGGGGAGATGAG
ACTGCCAAAAATCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTAAAGGTGGGGAGATGAG
ACTGCCAAAAATCCTCCGTGATTTTATTTTCCCAAGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis SK321 |
90.244 |
100 |
0.902 |
| comC/comC1 | Streptococcus pneumoniae R6 |
85.366 |
100 |
0.854 |
| comC/comC1 | Streptococcus pneumoniae G54 |
85.366 |
100 |
0.854 |
| comC/comC1 | Streptococcus pneumoniae D39 |
85.366 |
100 |
0.854 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
85.366 |
100 |
0.854 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |