Detailed information NTG1058418

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACFW99_RS12250
• Genome accession: NZ_CP170651
• Coordinates: 2535356..2535793 (-)
• Length: 145 a.a.
• NCBI ID: WP_043020787.1
• Uniprot ID: -
• Organism: Bacillus amyloliquefaciens strain JP5025
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2530356..2540793

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFW99_RS12200 (ACFW99_12200)	sinI	2530740..2530913 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACFW99_RS12205 (ACFW99_12205)	sinR	2530947..2531282 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACFW99_RS12210 (ACFW99_12210)	tasA	2531330..2532115 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACFW99_RS12215 (ACFW99_12215)	sipW	2532180..2532764 (-)	585	WP_061860711.1	signal peptidase I SipW	-
ACFW99_RS12220 (ACFW99_12220)	tapA	2532736..2533407 (-)	672	WP_060674605.1	amyloid fiber anchoring/assembly protein TapA	-
ACFW99_RS12225 (ACFW99_12225)	-	2533666..2533995 (+)	330	WP_060674607.1	DUF3889 domain-containing protein	-
ACFW99_RS12230 (ACFW99_12230)	-	2534035..2534214 (-)	180	WP_003153093.1	YqzE family protein	-
ACFW99_RS12235 (ACFW99_12235)	comGG	2534271..2534648 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACFW99_RS12240 (ACFW99_12240)	comGF	2534649..2535149 (-)	501	WP_254922226.1	competence type IV pilus minor pilin ComGF	-
ACFW99_RS12245 (ACFW99_12245)	comGE	2535058..2535372 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ACFW99_RS12250 (ACFW99_12250)	comGD	2535356..2535793 (-)	438	WP_043020787.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACFW99_RS12255 (ACFW99_12255)	comGC	2535783..2536091 (-)	309	WP_015417818.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFW99_RS12260 (ACFW99_12260)	comGB	2536096..2537133 (-)	1038	WP_015417819.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFW99_RS12265 (ACFW99_12265)	comGA	2537120..2538190 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFW99_RS12270 (ACFW99_12270)	-	2538383..2539333 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
ACFW99_RS12275 (ACFW99_12275)	-	2539479..2540780 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16271.77 Da
• Isoelectric Point: 10.2475

>NTDB_id=1058418 ACFW99_RS12250 WP_043020787.1 2535356..2535793(-) (comGD) [Bacillus amyloliquefaciens strain JP5025]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1058418 ACFW99_RS12250 WP_043020787.1 2535356..2535793(-) (comGD) [Bacillus amyloliquefaciens strain JP5025]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566