Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACFW99_RS12235 Genome accession   NZ_CP170651
Coordinates   2534271..2534648 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP5025     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2529271..2539648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFW99_RS12195 (ACFW99_12195) - 2529769..2530563 (+) 795 WP_156240427.1 YqhG family protein -
  ACFW99_RS12200 (ACFW99_12200) sinI 2530740..2530913 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFW99_RS12205 (ACFW99_12205) sinR 2530947..2531282 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFW99_RS12210 (ACFW99_12210) tasA 2531330..2532115 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFW99_RS12215 (ACFW99_12215) sipW 2532180..2532764 (-) 585 WP_061860711.1 signal peptidase I SipW -
  ACFW99_RS12220 (ACFW99_12220) tapA 2532736..2533407 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  ACFW99_RS12225 (ACFW99_12225) - 2533666..2533995 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  ACFW99_RS12230 (ACFW99_12230) - 2534035..2534214 (-) 180 WP_003153093.1 YqzE family protein -
  ACFW99_RS12235 (ACFW99_12235) comGG 2534271..2534648 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFW99_RS12240 (ACFW99_12240) comGF 2534649..2535149 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  ACFW99_RS12245 (ACFW99_12245) comGE 2535058..2535372 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACFW99_RS12250 (ACFW99_12250) comGD 2535356..2535793 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFW99_RS12255 (ACFW99_12255) comGC 2535783..2536091 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFW99_RS12260 (ACFW99_12260) comGB 2536096..2537133 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFW99_RS12265 (ACFW99_12265) comGA 2537120..2538190 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFW99_RS12270 (ACFW99_12270) - 2538383..2539333 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=1058417 ACFW99_RS12235 WP_015417814.1 2534271..2534648(-) (comGG) [Bacillus amyloliquefaciens strain JP5025]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1058417 ACFW99_RS12235 WP_015417814.1 2534271..2534648(-) (comGG) [Bacillus amyloliquefaciens strain JP5025]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment