Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | ACE2AN_RS00115 | Genome accession | NZ_CP169564 |
| Coordinates | 21590..21826 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939546.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 6_2F1 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..39052 | 21590..21826 | within | 0 |
| IS/Tn | 21067..21273 | 21590..21826 | flank | 317 |
Gene organization within MGE regions
Location: 12174..39052
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACE2AN_RS00065 | ftsH | 12174..14132 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| ACE2AN_RS00070 | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| ACE2AN_RS00105 | - | 20283..20492 (+) | 210 | Protein_14 | transposase | - |
| ACE2AN_RS00110 | - | 20527..21324 (-) | 798 | Protein_15 | transposase | - |
| ACE2AN_RS00115 | comW | 21590..21826 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| ACE2AN_RS00120 | - | 22057..23343 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| ACE2AN_RS00125 | tadA | 23544..24011 (+) | 468 | WP_000291875.1 | tRNA adenosine(34) deaminase TadA | - |
| ACE2AN_RS00135 | - | 24220..25356 (-) | 1137 | WP_001824497.1 | site-specific integrase | - |
| ACE2AN_RS00140 | - | 25417..26487 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| ACE2AN_RS00145 | - | 26504..26884 (-) | 381 | WP_081528400.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACE2AN_RS00150 | - | 26897..27160 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ACE2AN_RS00155 | - | 27160..27393 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| ACE2AN_RS00160 | - | 27393..27761 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| ACE2AN_RS00165 | - | 28175..28414 (-) | 240 | WP_000142893.1 | hypothetical protein | - |
| ACE2AN_RS00170 | - | 28479..28670 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| ACE2AN_RS00175 | - | 28693..28896 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| ACE2AN_RS00180 | - | 29051..29218 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| ACE2AN_RS00185 | - | 29223..29603 (+) | 381 | Protein_29 | autolysin | - |
| ACE2AN_RS00190 | - | 29888..30331 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| ACE2AN_RS00195 | - | 30333..30848 (+) | 516 | WP_061372761.1 | histidine phosphatase family protein | - |
| ACE2AN_RS00200 | radA | 30862..32223 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| ACE2AN_RS00205 | - | 32296..32793 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| ACE2AN_RS00210 | - | 32818..33601 (+) | 784 | Protein_34 | PrsW family glutamic-type intramembrane protease | - |
| ACE2AN_RS00215 | - | 33746..34714 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| ACE2AN_RS00220 | - | 34848..35129 (-) | 282 | Protein_36 | transposase family protein | - |
| ACE2AN_RS00225 | - | 35256..36163 (-) | 908 | Protein_37 | Rpn family recombination-promoting nuclease/putative transposase | - |
| ACE2AN_RS00230 | polA | 36419..39052 (+) | 2634 | WP_024478011.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9686.14 Da Isoelectric Point: 6.7051
>NTDB_id=1052158 ACE2AN_RS00115 WP_000939546.1 21590..21826(+) (comW) [Streptococcus pneumoniae strain 6_2F1]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=1052158 ACE2AN_RS00115 WP_000939546.1 21590..21826(+) (comW) [Streptococcus pneumoniae strain 6_2F1]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae D39 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae R6 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae TIGR4 |
98.718 |
100 |
0.987 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |