Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACEOOE_RS10050 | Genome accession | NZ_CP168717 |
| Coordinates | 2028158..2028628 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain C96 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1998265..2049041 | 2028158..2028628 | within | 0 |
Gene organization within MGE regions
Location: 1998265..2049041
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEOOE_RS09835 (ACEOOE_09835) | scn | 1998265..1998615 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| ACEOOE_RS09840 (ACEOOE_09840) | - | 1999126..1999464 (-) | 339 | Protein_1902 | SH3 domain-containing protein | - |
| ACEOOE_RS09845 (ACEOOE_09845) | sak | 2000112..2000603 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| ACEOOE_RS09850 (ACEOOE_09850) | - | 2000794..2001549 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ACEOOE_RS09855 (ACEOOE_09855) | - | 2001561..2001815 (-) | 255 | WP_000611512.1 | phage holin | - |
| ACEOOE_RS09860 (ACEOOE_09860) | - | 2001867..2001974 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| ACEOOE_RS09865 (ACEOOE_09865) | pepG1 | 2002027..2002161 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| ACEOOE_RS09870 (ACEOOE_09870) | sep | 2002406..2003188 (-) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| ACEOOE_RS09875 (ACEOOE_09875) | - | 2003600..2003974 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| ACEOOE_RS09880 (ACEOOE_09880) | - | 2004030..2004317 (-) | 288 | WP_001040255.1 | hypothetical protein | - |
| ACEOOE_RS09885 (ACEOOE_09885) | - | 2004364..2004516 (-) | 153 | WP_000654329.1 | hypothetical protein | - |
| ACEOOE_RS09890 (ACEOOE_09890) | - | 2004506..2008291 (-) | 3786 | WP_000582169.1 | phage tail spike protein | - |
| ACEOOE_RS09895 (ACEOOE_09895) | - | 2008307..2009791 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| ACEOOE_RS09900 (ACEOOE_09900) | - | 2009788..2014317 (-) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| ACEOOE_RS09905 (ACEOOE_09905) | gpGT | 2014374..2014511 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| ACEOOE_RS09910 (ACEOOE_09910) | gpG | 2014562..2014912 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| ACEOOE_RS09915 (ACEOOE_09915) | - | 2014962..2015186 (-) | 225 | WP_373443266.1 | Ig-like domain-containing protein | - |
| ACEOOE_RS09920 (ACEOOE_09920) | - | 2015228..2015872 (-) | 645 | WP_000268734.1 | major tail protein | - |
| ACEOOE_RS09925 (ACEOOE_09925) | - | 2015873..2016280 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| ACEOOE_RS09930 (ACEOOE_09930) | - | 2016277..2016681 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| ACEOOE_RS09935 (ACEOOE_09935) | - | 2016678..2017040 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| ACEOOE_RS09940 (ACEOOE_09940) | - | 2017024..2017308 (-) | 285 | WP_000150938.1 | phage head-tail connector protein | - |
| ACEOOE_RS09945 (ACEOOE_09945) | - | 2017298..2017582 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| ACEOOE_RS09950 (ACEOOE_09950) | - | 2017602..2018747 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| ACEOOE_RS09955 (ACEOOE_09955) | - | 2018771..2019508 (-) | 738 | WP_000642727.1 | head maturation protease, ClpP-related | - |
| ACEOOE_RS09960 (ACEOOE_09960) | - | 2019492..2020679 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| ACEOOE_RS09965 (ACEOOE_09965) | - | 2020695..2022356 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| ACEOOE_RS09970 (ACEOOE_09970) | - | 2022353..2022697 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| ACEOOE_RS09975 (ACEOOE_09975) | - | 2022827..2023126 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| ACEOOE_RS09980 (ACEOOE_09980) | - | 2023358..2023774 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| ACEOOE_RS09985 (ACEOOE_09985) | - | 2023802..2024002 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| ACEOOE_RS09990 (ACEOOE_09990) | rinB | 2024002..2024151 (-) | 150 | WP_000595264.1 | transcriptional activator RinB | - |
| ACEOOE_RS09995 (ACEOOE_09995) | - | 2024148..2024534 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| ACEOOE_RS10000 (ACEOOE_10000) | - | 2024531..2024737 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| ACEOOE_RS10005 (ACEOOE_10005) | - | 2024734..2024979 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| ACEOOE_RS10010 (ACEOOE_10010) | - | 2025016..2025552 (-) | 537 | WP_001066448.1 | dUTP diphosphatase | - |
| ACEOOE_RS10015 (ACEOOE_10015) | - | 2025545..2025715 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| ACEOOE_RS10020 (ACEOOE_10020) | - | 2025702..2025956 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| ACEOOE_RS10025 (ACEOOE_10025) | - | 2025971..2026213 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| ACEOOE_RS10030 (ACEOOE_10030) | - | 2026217..2026585 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACEOOE_RS10035 (ACEOOE_10035) | - | 2026598..2027000 (-) | 403 | Protein_1941 | RusA family crossover junction endodeoxyribonuclease | - |
| ACEOOE_RS10040 (ACEOOE_10040) | - | 2027009..2027227 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| ACEOOE_RS10045 (ACEOOE_10045) | - | 2027234..2028128 (-) | 895 | Protein_1943 | DnaD domain protein | - |
| ACEOOE_RS10050 (ACEOOE_10050) | ssbA | 2028158..2028628 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| ACEOOE_RS10055 (ACEOOE_10055) | - | 2028629..2029246 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| ACEOOE_RS10060 (ACEOOE_10060) | - | 2029327..2030247 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| ACEOOE_RS10065 (ACEOOE_10065) | - | 2030249..2032192 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| ACEOOE_RS10070 (ACEOOE_10070) | - | 2032201..2032464 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| ACEOOE_RS10075 (ACEOOE_10075) | - | 2032473..2032733 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| ACEOOE_RS10080 (ACEOOE_10080) | - | 2032738..2033040 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| ACEOOE_RS10085 (ACEOOE_10085) | - | 2033133..2033294 (-) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| ACEOOE_RS10090 (ACEOOE_10090) | - | 2033291..2033611 (-) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| ACEOOE_RS10095 (ACEOOE_10095) | - | 2033641..2033769 (-) | 129 | WP_256026162.1 | hypothetical protein | - |
| ACEOOE_RS10100 (ACEOOE_10100) | - | 2033760..2033859 (-) | 100 | Protein_1954 | hypothetical protein | - |
| ACEOOE_RS10105 (ACEOOE_10105) | - | 2033890..2034084 (-) | 195 | WP_000388066.1 | hypothetical protein | - |
| ACEOOE_RS10110 (ACEOOE_10110) | - | 2034101..2034853 (-) | 753 | WP_001148606.1 | phage antirepressor KilAC domain-containing protein | - |
| ACEOOE_RS10115 (ACEOOE_10115) | - | 2034904..2035233 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| ACEOOE_RS10120 (ACEOOE_10120) | - | 2035222..2035437 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| ACEOOE_RS10125 (ACEOOE_10125) | - | 2035453..2035716 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| ACEOOE_RS10130 (ACEOOE_10130) | - | 2035713..2035886 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| ACEOOE_RS10135 (ACEOOE_10135) | - | 2035849..2036562 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| ACEOOE_RS10140 (ACEOOE_10140) | - | 2036578..2037510 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| ACEOOE_RS10145 (ACEOOE_10145) | - | 2037516..2037857 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| ACEOOE_RS10150 (ACEOOE_10150) | - | 2038061..2038243 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| ACEOOE_RS10155 (ACEOOE_10155) | - | 2038343..2038807 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| ACEOOE_RS10160 (ACEOOE_10160) | - | 2038866..2039903 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| ACEOOE_RS10165 (ACEOOE_10165) | sph | 2039960..2040784 (+) | 825 | Protein_1967 | sphingomyelin phosphodiesterase | - |
| ACEOOE_RS10170 (ACEOOE_10170) | lukG | 2041022..2042038 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| ACEOOE_RS10175 (ACEOOE_10175) | lukH | 2042060..2043115 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| ACEOOE_RS10180 (ACEOOE_10180) | - | 2043551..2044774 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| ACEOOE_RS10185 (ACEOOE_10185) | - | 2045218..2046525 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| ACEOOE_RS10190 (ACEOOE_10190) | groL | 2047065..2048681 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| ACEOOE_RS10195 (ACEOOE_10195) | groES | 2048757..2049041 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1045255 ACEOOE_RS10050 WP_000934760.1 2028158..2028628(-) (ssbA) [Staphylococcus aureus strain C96]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1045255 ACEOOE_RS10050 WP_000934760.1 2028158..2028628(-) (ssbA) [Staphylococcus aureus strain C96]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |