Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACDZ06_RS10060 | Genome accession | NZ_CP168010 |
| Coordinates | 2030978..2031448 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain sa231003_barcode77 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2003006..2055988 | 2030978..2031448 | within | 0 |
Gene organization within MGE regions
Location: 2003006..2055988
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACDZ06_RS09860 (ACDZ06_09860) | scn | 2003006..2003356 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| ACDZ06_RS09865 (ACDZ06_09865) | - | 2003867..2004208 (-) | 342 | Protein_1905 | SH3 domain-containing protein | - |
| ACDZ06_RS09870 (ACDZ06_09870) | sak | 2004810..2005301 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| ACDZ06_RS09875 (ACDZ06_09875) | - | 2005492..2006247 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ACDZ06_RS09880 (ACDZ06_09880) | - | 2006259..2006513 (-) | 255 | WP_000611512.1 | phage holin | - |
| ACDZ06_RS09885 (ACDZ06_09885) | - | 2006565..2006672 (+) | 108 | WP_031790389.1 | hypothetical protein | - |
| ACDZ06_RS09890 (ACDZ06_09890) | pepG1 | 2006725..2006859 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| ACDZ06_RS09895 (ACDZ06_09895) | - | 2007051..2007347 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| ACDZ06_RS09900 (ACDZ06_09900) | - | 2007405..2007692 (-) | 288 | WP_001040254.1 | hypothetical protein | - |
| ACDZ06_RS09905 (ACDZ06_09905) | - | 2007739..2007891 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| ACDZ06_RS09910 (ACDZ06_09910) | - | 2007881..2011666 (-) | 3786 | WP_061737661.1 | phage tail spike protein | - |
| ACDZ06_RS09915 (ACDZ06_09915) | - | 2011682..2013166 (-) | 1485 | WP_420195877.1 | phage distal tail protein | - |
| ACDZ06_RS09920 (ACDZ06_09920) | - | 2013163..2017707 (-) | 4545 | WP_420195878.1 | phage tail tape measure protein | - |
| ACDZ06_RS09925 (ACDZ06_09925) | gpGT | 2017764..2017901 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| ACDZ06_RS09930 (ACDZ06_09930) | gpG | 2017952..2018302 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| ACDZ06_RS09935 (ACDZ06_09935) | - | 2018353..2018583 (-) | 231 | Protein_1919 | Ig-like domain-containing protein | - |
| ACDZ06_RS09940 (ACDZ06_09940) | - | 2018619..2019260 (-) | 642 | WP_000985141.1 | major tail protein | - |
| ACDZ06_RS09945 (ACDZ06_09945) | - | 2019261..2019668 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| ACDZ06_RS09950 (ACDZ06_09950) | - | 2019665..2020069 (-) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| ACDZ06_RS09955 (ACDZ06_09955) | - | 2020066..2020428 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| ACDZ06_RS09960 (ACDZ06_09960) | - | 2020412..2020696 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| ACDZ06_RS09965 (ACDZ06_09965) | - | 2020686..2020970 (-) | 285 | WP_000238240.1 | hypothetical protein | - |
| ACDZ06_RS09970 (ACDZ06_09970) | - | 2020990..2022135 (-) | 1146 | WP_000154567.1 | phage major capsid protein | - |
| ACDZ06_RS09975 (ACDZ06_09975) | - | 2022158..2022895 (-) | 738 | WP_000861911.1 | head maturation protease, ClpP-related | - |
| ACDZ06_RS09980 (ACDZ06_09980) | - | 2022879..2024042 (-) | 1164 | WP_000025268.1 | phage portal protein | - |
| ACDZ06_RS09985 (ACDZ06_09985) | - | 2024058..2025719 (-) | 1662 | WP_000625096.1 | terminase large subunit | - |
| ACDZ06_RS09990 (ACDZ06_09990) | - | 2025716..2026060 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| ACDZ06_RS09995 (ACDZ06_09995) | - | 2026190..2026489 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| ACDZ06_RS10000 (ACDZ06_10000) | - | 2026721..2027137 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| ACDZ06_RS10005 (ACDZ06_10005) | - | 2027165..2027365 (-) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| ACDZ06_RS10010 (ACDZ06_10010) | rinB | 2027365..2027514 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| ACDZ06_RS10015 (ACDZ06_10015) | - | 2027511..2027717 (-) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| ACDZ06_RS10020 (ACDZ06_10020) | - | 2027714..2027959 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| ACDZ06_RS10025 (ACDZ06_10025) | - | 2027996..2028532 (-) | 537 | WP_000185693.1 | dUTPase | - |
| ACDZ06_RS10030 (ACDZ06_10030) | - | 2028529..2028774 (-) | 246 | WP_061740473.1 | DUF1024 family protein | - |
| ACDZ06_RS10035 (ACDZ06_10035) | - | 2028789..2029031 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| ACDZ06_RS10040 (ACDZ06_10040) | - | 2029035..2029403 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACDZ06_RS10045 (ACDZ06_10045) | - | 2029416..2029821 (-) | 406 | Protein_1941 | RusA family crossover junction endodeoxyribonuclease | - |
| ACDZ06_RS10050 (ACDZ06_10050) | - | 2029830..2030048 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| ACDZ06_RS10055 (ACDZ06_10055) | - | 2030055..2030948 (-) | 894 | WP_000148321.1 | DnaD domain protein | - |
| ACDZ06_RS10060 (ACDZ06_10060) | ssbA | 2030978..2031448 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| ACDZ06_RS10065 (ACDZ06_10065) | - | 2031449..2032066 (-) | 618 | WP_072460574.1 | MBL fold metallo-hydrolase | - |
| ACDZ06_RS10070 (ACDZ06_10070) | - | 2032147..2033067 (-) | 921 | WP_000138481.1 | recombinase RecT | - |
| ACDZ06_RS10075 (ACDZ06_10075) | - | 2033069..2035024 (-) | 1956 | WP_172595233.1 | AAA family ATPase | - |
| ACDZ06_RS10080 (ACDZ06_10080) | - | 2035021..2035284 (-) | 264 | WP_420195879.1 | hypothetical protein | - |
| ACDZ06_RS10085 (ACDZ06_10085) | - | 2035293..2035553 (-) | 261 | WP_031763794.1 | DUF1108 family protein | - |
| ACDZ06_RS10090 (ACDZ06_10090) | - | 2035558..2035860 (-) | 303 | WP_044131919.1 | DUF2482 family protein | - |
| ACDZ06_RS10095 (ACDZ06_10095) | - | 2035953..2036114 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| ACDZ06_RS10100 (ACDZ06_10100) | - | 2036111..2036431 (-) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| ACDZ06_RS10105 (ACDZ06_10105) | - | 2036580..2036679 (-) | 100 | Protein_1953 | hypothetical protein | - |
| ACDZ06_RS10110 (ACDZ06_10110) | - | 2036676..2037002 (-) | 327 | WP_001025595.1 | hypothetical protein | - |
| ACDZ06_RS10115 (ACDZ06_10115) | - | 2037329..2037568 (-) | 240 | WP_001294156.1 | hypothetical protein | - |
| ACDZ06_RS10120 (ACDZ06_10120) | - | 2037627..2037830 (+) | 204 | WP_031768726.1 | hypothetical protein | - |
| ACDZ06_RS10125 (ACDZ06_10125) | - | 2037839..2037922 (-) | 84 | Protein_1957 | hypothetical protein | - |
| ACDZ06_RS10130 (ACDZ06_10130) | - | 2037947..2038687 (-) | 741 | WP_061740475.1 | phage antirepressor KilAC domain-containing protein | - |
| ACDZ06_RS10135 (ACDZ06_10135) | - | 2038704..2039150 (-) | 447 | WP_001620116.1 | hypothetical protein | - |
| ACDZ06_RS10140 (ACDZ06_10140) | - | 2039163..2039405 (-) | 243 | WP_000639923.1 | DUF739 family protein | - |
| ACDZ06_RS10145 (ACDZ06_10145) | - | 2039569..2040285 (+) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| ACDZ06_RS10150 (ACDZ06_10150) | - | 2040297..2041151 (+) | 855 | WP_001620117.1 | HIRAN domain-containing protein | - |
| ACDZ06_RS10155 (ACDZ06_10155) | - | 2041225..2041371 (+) | 147 | WP_000345949.1 | hypothetical protein | - |
| ACDZ06_RS10160 (ACDZ06_10160) | - | 2041368..2041553 (+) | 186 | WP_000109189.1 | hypothetical protein | - |
| ACDZ06_RS10165 (ACDZ06_10165) | - | 2041624..2041806 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| ACDZ06_RS10170 (ACDZ06_10170) | - | 2041884..2042597 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACDZ06_RS10175 (ACDZ06_10175) | - | 2042788..2043825 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| ACDZ06_RS10180 (ACDZ06_10180) | sph | 2043882..2044706 (+) | 825 | Protein_1968 | sphingomyelin phosphodiesterase | - |
| ACDZ06_RS10185 (ACDZ06_10185) | lukG | 2044944..2045960 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| ACDZ06_RS10190 (ACDZ06_10190) | lukH | 2045982..2047037 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| ACDZ06_RS10195 (ACDZ06_10195) | - | 2047473..2048696 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| ACDZ06_RS10200 (ACDZ06_10200) | - | 2049140..2050447 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| ACDZ06_RS10205 (ACDZ06_10205) | groL | 2050987..2052603 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| ACDZ06_RS10210 (ACDZ06_10210) | groES | 2052679..2052963 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| ACDZ06_RS10215 (ACDZ06_10215) | mroQ | 2053138..2053881 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| ACDZ06_RS10220 (ACDZ06_10220) | - | 2053906..2055165 (-) | 1260 | WP_000120297.1 | SdrH family protein | - |
| ACDZ06_RS10225 (ACDZ06_10225) | - | 2055362..2055988 (+) | 627 | WP_000522381.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1041133 ACDZ06_RS10060 WP_000934760.1 2030978..2031448(-) (ssbA) [Staphylococcus aureus strain sa231003_barcode77]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1041133 ACDZ06_RS10060 WP_000934760.1 2030978..2031448(-) (ssbA) [Staphylococcus aureus strain sa231003_barcode77]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |