Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACBW56_RS01795 Genome accession   NZ_CP167196
Coordinates   345186..345563 (+) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain FRI-TD24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 340186..350563
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACBW56_RS01760 (ACBW56_01760) - 340503..341453 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  ACBW56_RS01765 (ACBW56_01765) comGA 341645..342715 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACBW56_RS01770 (ACBW56_01770) comGB 342702..343738 (+) 1037 Protein_349 competence type IV pilus assembly protein ComGB -
  ACBW56_RS01775 (ACBW56_01775) comGC 343785..344051 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACBW56_RS01780 (ACBW56_01780) comGD 344041..344478 (+) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACBW56_RS01785 (ACBW56_01785) comGE 344462..344776 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACBW56_RS01790 (ACBW56_01790) comGF 344790..345185 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  ACBW56_RS01795 (ACBW56_01795) comGG 345186..345563 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACBW56_RS01800 (ACBW56_01800) - 345620..345799 (+) 180 WP_003153093.1 YqzE family protein -
  ACBW56_RS01805 (ACBW56_01805) - 345839..346168 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACBW56_RS01810 (ACBW56_01810) tapA 346427..347098 (+) 672 WP_330729170.1 amyloid fiber anchoring/assembly protein TapA -
  ACBW56_RS01815 (ACBW56_01815) sipW 347070..347654 (+) 585 WP_012117977.1 signal peptidase I SipW -
  ACBW56_RS01820 (ACBW56_01820) tasA 347718..348503 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACBW56_RS01825 (ACBW56_01825) sinR 348551..348886 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACBW56_RS01830 (ACBW56_01830) sinI 348920..349093 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACBW56_RS01835 (ACBW56_01835) - 349270..350064 (-) 795 WP_003153106.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=1038746 ACBW56_RS01795 WP_014305410.1 345186..345563(+) (comGG) [Bacillus velezensis strain FRI-TD24]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1038746 ACBW56_RS01795 WP_014305410.1 345186..345563(+) (comGG) [Bacillus velezensis strain FRI-TD24]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment