Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACBW56_RS01830 | Genome accession | NZ_CP167196 |
| Coordinates | 348920..349093 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain FRI-TD24 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 343920..354093
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACBW56_RS01780 (ACBW56_01780) | comGD | 344041..344478 (+) | 438 | WP_072588444.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACBW56_RS01785 (ACBW56_01785) | comGE | 344462..344776 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACBW56_RS01790 (ACBW56_01790) | comGF | 344790..345185 (+) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| ACBW56_RS01795 (ACBW56_01795) | comGG | 345186..345563 (+) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACBW56_RS01800 (ACBW56_01800) | - | 345620..345799 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACBW56_RS01805 (ACBW56_01805) | - | 345839..346168 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACBW56_RS01810 (ACBW56_01810) | tapA | 346427..347098 (+) | 672 | WP_330729170.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACBW56_RS01815 (ACBW56_01815) | sipW | 347070..347654 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACBW56_RS01820 (ACBW56_01820) | tasA | 347718..348503 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACBW56_RS01825 (ACBW56_01825) | sinR | 348551..348886 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACBW56_RS01830 (ACBW56_01830) | sinI | 348920..349093 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACBW56_RS01835 (ACBW56_01835) | - | 349270..350064 (-) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACBW56_RS01840 (ACBW56_01840) | - | 350082..351752 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACBW56_RS01845 (ACBW56_01845) | gcvT | 352175..353275 (+) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1038748 ACBW56_RS01830 WP_003153105.1 348920..349093(-) (sinI) [Bacillus velezensis strain FRI-TD24]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1038748 ACBW56_RS01830 WP_003153105.1 348920..349093(-) (sinI) [Bacillus velezensis strain FRI-TD24]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |