Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AB6K15_RS18020 Genome accession   NZ_CP166492
Coordinates   3642681..3643058 (+) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain BC248L1-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3637681..3648058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6K15_RS17985 (AB6K15_17975) - 3637995..3638945 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  AB6K15_RS17990 (AB6K15_17980) comGA 3639139..3640209 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB6K15_RS17995 (AB6K15_17985) comGB 3640196..3641233 (+) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB6K15_RS18000 (AB6K15_17990) comGC 3641280..3641546 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  AB6K15_RS18005 (AB6K15_17995) comGD 3641536..3641973 (+) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB6K15_RS18010 (AB6K15_18000) comGE 3641957..3642271 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB6K15_RS18015 (AB6K15_18005) comGF 3642180..3642680 (+) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  AB6K15_RS18020 (AB6K15_18010) comGG 3642681..3643058 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6K15_RS18025 (AB6K15_18015) - 3643115..3643294 (+) 180 WP_003153093.1 YqzE family protein -
  AB6K15_RS18030 (AB6K15_18020) - 3643334..3643663 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB6K15_RS18035 (AB6K15_18025) tapA 3643922..3644593 (+) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  AB6K15_RS18040 (AB6K15_18030) sipW 3644565..3645149 (+) 585 WP_015240205.1 signal peptidase I SipW -
  AB6K15_RS18045 (AB6K15_18035) tasA 3645214..3645999 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB6K15_RS18050 (AB6K15_18040) sinR 3646047..3646382 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB6K15_RS18055 (AB6K15_18045) sinI 3646416..3646589 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB6K15_RS18060 (AB6K15_18050) - 3646766..3647560 (-) 795 WP_076424968.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1034777 AB6K15_RS18020 WP_012117980.1 3642681..3643058(+) (comGG) [Bacillus velezensis strain BC248L1-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1034777 AB6K15_RS18020 WP_012117980.1 3642681..3643058(+) (comGG) [Bacillus velezensis strain BC248L1-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment