Detailed information NTG1034776

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB6K15_RS18005
• Genome accession: NZ_CP166492
• Coordinates: 3641536..3641973 (+)
• Length: 145 a.a.
• NCBI ID: WP_043020787.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain BC248L1-1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3636536..3646973

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB6K15_RS17980 (AB6K15_17970)	-	3636548..3637849 (-)	1302	WP_021494315.1	hemolysin family protein	-
AB6K15_RS17985 (AB6K15_17975)	-	3637995..3638945 (+)	951	WP_007408319.1	magnesium transporter CorA family protein	-
AB6K15_RS17990 (AB6K15_17980)	comGA	3639139..3640209 (+)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB6K15_RS17995 (AB6K15_17985)	comGB	3640196..3641233 (+)	1038	WP_094031834.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB6K15_RS18000 (AB6K15_17990)	comGC	3641280..3641546 (+)	267	WP_042635730.1	competence type IV pilus major pilin ComGC	Machinery gene
AB6K15_RS18005 (AB6K15_17995)	comGD	3641536..3641973 (+)	438	WP_043020787.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB6K15_RS18010 (AB6K15_18000)	comGE	3641957..3642271 (+)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
AB6K15_RS18015 (AB6K15_18005)	comGF	3642180..3642680 (+)	501	WP_257899725.1	competence type IV pilus minor pilin ComGF	-
AB6K15_RS18020 (AB6K15_18010)	comGG	3642681..3643058 (+)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB6K15_RS18025 (AB6K15_18015)	-	3643115..3643294 (+)	180	WP_003153093.1	YqzE family protein	-
AB6K15_RS18030 (AB6K15_18020)	-	3643334..3643663 (-)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB6K15_RS18035 (AB6K15_18025)	tapA	3643922..3644593 (+)	672	WP_124934997.1	amyloid fiber anchoring/assembly protein TapA	-
AB6K15_RS18040 (AB6K15_18030)	sipW	3644565..3645149 (+)	585	WP_015240205.1	signal peptidase I SipW	-
AB6K15_RS18045 (AB6K15_18035)	tasA	3645214..3645999 (+)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB6K15_RS18050 (AB6K15_18040)	sinR	3646047..3646382 (-)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB6K15_RS18055 (AB6K15_18045)	sinI	3646416..3646589 (-)	174	WP_003153105.1	anti-repressor SinI	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16271.77 Da
• Isoelectric Point: 10.2475

>NTDB_id=1034776 AB6K15_RS18005 WP_043020787.1 3641536..3641973(+) (comGD) [Bacillus velezensis strain BC248L1-1]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1034776 AB6K15_RS18005 WP_043020787.1 3641536..3641973(+) (comGD) [Bacillus velezensis strain BC248L1-1]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566