Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB6K15_RS18055 | Genome accession | NZ_CP166492 |
| Coordinates | 3646416..3646589 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BC248L1-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3641416..3651589
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6K15_RS18005 (AB6K15_17995) | comGD | 3641536..3641973 (+) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AB6K15_RS18010 (AB6K15_18000) | comGE | 3641957..3642271 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB6K15_RS18015 (AB6K15_18005) | comGF | 3642180..3642680 (+) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| AB6K15_RS18020 (AB6K15_18010) | comGG | 3642681..3643058 (+) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB6K15_RS18025 (AB6K15_18015) | - | 3643115..3643294 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB6K15_RS18030 (AB6K15_18020) | - | 3643334..3643663 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB6K15_RS18035 (AB6K15_18025) | tapA | 3643922..3644593 (+) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB6K15_RS18040 (AB6K15_18030) | sipW | 3644565..3645149 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| AB6K15_RS18045 (AB6K15_18035) | tasA | 3645214..3645999 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB6K15_RS18050 (AB6K15_18040) | sinR | 3646047..3646382 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB6K15_RS18055 (AB6K15_18045) | sinI | 3646416..3646589 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB6K15_RS18060 (AB6K15_18050) | - | 3646766..3647560 (-) | 795 | WP_076424968.1 | YqhG family protein | - |
| AB6K15_RS18065 (AB6K15_18055) | - | 3647582..3649252 (-) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| AB6K15_RS18070 (AB6K15_18060) | gcvT | 3649676..3650776 (+) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1034779 AB6K15_RS18055 WP_003153105.1 3646416..3646589(-) (sinI) [Bacillus velezensis strain BC248L1-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1034779 AB6K15_RS18055 WP_003153105.1 3646416..3646589(-) (sinI) [Bacillus velezensis strain BC248L1-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |