Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB3437_RS00365 | Genome accession | NZ_CP162458 |
| Coordinates | 64831..65301 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain TUM20914 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 36297..95047 | 64831..65301 | within | 0 |
Gene organization within MGE regions
Location: 36297..95047
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3437_RS00175 (AB3437_00175) | - | 36297..36923 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| AB3437_RS00180 (AB3437_00180) | - | 37120..38301 (+) | 1182 | WP_000120303.1 | SdrH family protein | - |
| AB3437_RS00185 (AB3437_00185) | mroQ | 38326..39069 (-) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| AB3437_RS00190 (AB3437_00190) | groES | 39244..39528 (+) | 285 | WP_212556265.1 | co-chaperone GroES | - |
| AB3437_RS00195 (AB3437_00195) | groL | 39604..41220 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| AB3437_RS00200 (AB3437_00200) | - | 41315..41861 (-) | 547 | Protein_36 | site-specific integrase | - |
| AB3437_RS00205 (AB3437_00205) | - | 41922..42134 (+) | 213 | WP_000128898.1 | hypothetical protein | - |
| AB3437_RS00210 (AB3437_00210) | - | 42131..42721 (+) | 591 | WP_001293058.1 | terminase small subunit | - |
| AB3437_RS00215 (AB3437_00215) | - | 43039..43476 (+) | 438 | WP_011447041.1 | hypothetical protein | - |
| AB3437_RS00220 (AB3437_00220) | - | 43582..44025 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| AB3437_RS00225 (AB3437_00225) | - | 44878..46185 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| AB3437_RS00230 (AB3437_00230) | - | 46346..47257 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| AB3437_RS00235 (AB3437_00235) | - | 47319..48164 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| AB3437_RS00240 (AB3437_00240) | - | 48536..49759 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| AB3437_RS00245 (AB3437_00245) | lukH | 50194..51249 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AB3437_RS00250 (AB3437_00250) | lukG | 51271..52287 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AB3437_RS00255 (AB3437_00255) | sph | 52525..53349 (-) | 825 | Protein_47 | sphingomyelin phosphodiesterase | - |
| AB3437_RS00260 (AB3437_00260) | - | 53406..54443 (-) | 1038 | WP_000857191.1 | site-specific integrase | - |
| AB3437_RS00265 (AB3437_00265) | - | 54502..54966 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| AB3437_RS00270 (AB3437_00270) | - | 55066..55248 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| AB3437_RS00275 (AB3437_00275) | - | 55452..55793 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| AB3437_RS00280 (AB3437_00280) | - | 55799..56731 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AB3437_RS00285 (AB3437_00285) | - | 56747..57460 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AB3437_RS00290 (AB3437_00290) | - | 57423..57596 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| AB3437_RS00295 (AB3437_00295) | - | 57593..57856 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AB3437_RS00300 (AB3437_00300) | - | 57872..58087 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AB3437_RS00305 (AB3437_00305) | - | 58076..58405 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| AB3437_RS00310 (AB3437_00310) | - | 58456..59208 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| AB3437_RS00315 (AB3437_00315) | - | 59224..59421 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| AB3437_RS00320 (AB3437_00320) | - | 59408..59788 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| AB3437_RS00325 (AB3437_00325) | - | 59843..60166 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| AB3437_RS00330 (AB3437_00330) | - | 60163..60324 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| AB3437_RS00335 (AB3437_00335) | - | 60419..60721 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| AB3437_RS00340 (AB3437_00340) | - | 60726..60986 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| AB3437_RS00345 (AB3437_00345) | - | 60995..61258 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| AB3437_RS00350 (AB3437_00350) | - | 61267..63210 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| AB3437_RS00355 (AB3437_00355) | - | 63212..64132 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| AB3437_RS00360 (AB3437_00360) | - | 64213..64830 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AB3437_RS00365 (AB3437_00365) | ssbA | 64831..65301 (+) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| AB3437_RS00370 (AB3437_00370) | - | 65331..66224 (+) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| AB3437_RS00375 (AB3437_00375) | - | 66231..66449 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| AB3437_RS00380 (AB3437_00380) | - | 66458..66862 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AB3437_RS00385 (AB3437_00385) | - | 66875..67243 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AB3437_RS00390 (AB3437_00390) | - | 67247..67489 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| AB3437_RS00395 (AB3437_00395) | - | 67504..67752 (+) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| AB3437_RS00400 (AB3437_00400) | - | 67745..68281 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| AB3437_RS00405 (AB3437_00405) | - | 68318..68563 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| AB3437_RS00410 (AB3437_00410) | - | 68560..68766 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AB3437_RS00415 (AB3437_00415) | - | 68763..69149 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| AB3437_RS00420 (AB3437_00420) | - | 69146..69295 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AB3437_RS00425 (AB3437_00425) | - | 69295..69495 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AB3437_RS00430 (AB3437_00430) | - | 69523..69939 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| AB3437_RS00435 (AB3437_00435) | - | 70171..70470 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AB3437_RS00440 (AB3437_00440) | - | 70600..70944 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| AB3437_RS00445 (AB3437_00445) | - | 70941..72602 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AB3437_RS00450 (AB3437_00450) | - | 72618..73805 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| AB3437_RS00455 (AB3437_00455) | - | 73789..74526 (+) | 738 | WP_000642727.1 | head maturation protease, ClpP-related | - |
| AB3437_RS00460 (AB3437_00460) | - | 74550..75695 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AB3437_RS00465 (AB3437_00465) | - | 75715..75999 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| AB3437_RS00470 (AB3437_00470) | - | 75989..76273 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AB3437_RS00475 (AB3437_00475) | - | 76257..76619 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AB3437_RS00480 (AB3437_00480) | - | 76616..77020 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| AB3437_RS00485 (AB3437_00485) | - | 77017..77424 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| AB3437_RS00490 (AB3437_00490) | - | 77425..78069 (+) | 645 | WP_000268735.1 | major tail protein | - |
| AB3437_RS00495 (AB3437_00495) | - | 78105..78335 (+) | 231 | Protein_95 | Ig-like domain-containing protein | - |
| AB3437_RS00500 (AB3437_00500) | - | 78385..78735 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| AB3437_RS00505 (AB3437_00505) | - | 78786..78923 (+) | 138 | WP_001549167.1 | hypothetical protein | - |
| AB3437_RS00510 (AB3437_00510) | - | 78980..83524 (+) | 4545 | WP_000504557.1 | phage tail tape measure protein | - |
| AB3437_RS00515 (AB3437_00515) | - | 83521..85005 (+) | 1485 | WP_000567393.1 | phage tail domain-containing protein | - |
| AB3437_RS00520 (AB3437_00520) | - | 85021..88806 (+) | 3786 | WP_341263886.1 | phage tail spike protein | - |
| AB3437_RS00525 (AB3437_00525) | - | 88796..88948 (+) | 153 | WP_000654329.1 | hypothetical protein | - |
| AB3437_RS00530 (AB3437_00530) | - | 88995..89282 (+) | 288 | WP_001040255.1 | hypothetical protein | - |
| AB3437_RS00535 (AB3437_00535) | - | 89338..89712 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| AB3437_RS00540 (AB3437_00540) | sep | 90124..90906 (+) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| AB3437_RS00545 (AB3437_00545) | pepG1 | 91151..91285 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AB3437_RS00550 (AB3437_00550) | - | 91338..91445 (-) | 108 | WP_031762631.1 | hypothetical protein | - |
| AB3437_RS00555 (AB3437_00555) | - | 91497..91751 (+) | 255 | WP_000611512.1 | phage holin | - |
| AB3437_RS00560 (AB3437_00560) | - | 91763..92518 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AB3437_RS00565 (AB3437_00565) | sak | 92709..93200 (+) | 492 | WP_000920038.1 | staphylokinase | - |
| AB3437_RS00570 (AB3437_00570) | - | 93851..94186 (+) | 336 | Protein_110 | SH3 domain-containing protein | - |
| AB3437_RS00575 (AB3437_00575) | scn | 94697..95047 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1025973 AB3437_RS00365 WP_000934760.1 64831..65301(+) (ssbA) [Staphylococcus aureus strain TUM20914]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1025973 AB3437_RS00365 WP_000934760.1 64831..65301(+) (ssbA) [Staphylococcus aureus strain TUM20914]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |