Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB0R82_RS12340 Genome accession   NZ_CP160220
Coordinates   2416214..2416597 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain JM553     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2411214..2421597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R82_RS12300 (AB0R82_12300) sinI 2412148..2412321 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB0R82_RS12305 (AB0R82_12305) sinR 2412355..2412690 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB0R82_RS12310 (AB0R82_12310) tasA 2412783..2413568 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  AB0R82_RS12315 (AB0R82_12315) sipW 2413632..2414204 (-) 573 WP_072692741.1 signal peptidase I SipW -
  AB0R82_RS12320 (AB0R82_12320) tapA 2414188..2414949 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R82_RS12325 (AB0R82_12325) yqzG 2415221..2415547 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB0R82_RS12330 (AB0R82_12330) spoIITA 2415589..2415768 (-) 180 WP_072175549.1 YqzE family protein -
  AB0R82_RS12335 (AB0R82_12335) comGG 2415839..2416213 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  AB0R82_RS12340 (AB0R82_12340) comGF 2416214..2416597 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  AB0R82_RS12345 (AB0R82_12345) comGE 2416623..2416970 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  AB0R82_RS12350 (AB0R82_12350) comGD 2416954..2417385 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  AB0R82_RS12355 (AB0R82_12355) comGC 2417375..2417671 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB0R82_RS12360 (AB0R82_12360) comGB 2417685..2418722 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  AB0R82_RS12365 (AB0R82_12365) comGA 2418709..2419779 (-) 1071 WP_129134318.1 competence protein ComGA Machinery gene
  AB0R82_RS12370 (AB0R82_12370) - 2419991..2420188 (-) 198 WP_129134319.1 hypothetical protein -
  AB0R82_RS12375 (AB0R82_12375) corA 2420190..2421143 (-) 954 WP_198878633.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=1019698 AB0R82_RS12340 WP_032726158.1 2416214..2416597(-) (comGF) [Bacillus subtilis strain JM553]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1019698 AB0R82_RS12340 WP_032726158.1 2416214..2416597(-) (comGF) [Bacillus subtilis strain JM553]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment