Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB0R82_RS12300 Genome accession   NZ_CP160220
Coordinates   2412148..2412321 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain JM553     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2407148..2417321
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R82_RS12285 (AB0R82_12285) gcvT 2407947..2409035 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  AB0R82_RS12290 (AB0R82_12290) hepAA 2409477..2411150 (+) 1674 WP_198878635.1 SNF2-related protein -
  AB0R82_RS12295 (AB0R82_12295) yqhG 2411171..2411965 (+) 795 WP_003230200.1 YqhG family protein -
  AB0R82_RS12300 (AB0R82_12300) sinI 2412148..2412321 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB0R82_RS12305 (AB0R82_12305) sinR 2412355..2412690 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB0R82_RS12310 (AB0R82_12310) tasA 2412783..2413568 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  AB0R82_RS12315 (AB0R82_12315) sipW 2413632..2414204 (-) 573 WP_072692741.1 signal peptidase I SipW -
  AB0R82_RS12320 (AB0R82_12320) tapA 2414188..2414949 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R82_RS12325 (AB0R82_12325) yqzG 2415221..2415547 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB0R82_RS12330 (AB0R82_12330) spoIITA 2415589..2415768 (-) 180 WP_072175549.1 YqzE family protein -
  AB0R82_RS12335 (AB0R82_12335) comGG 2415839..2416213 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  AB0R82_RS12340 (AB0R82_12340) comGF 2416214..2416597 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  AB0R82_RS12345 (AB0R82_12345) comGE 2416623..2416970 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1019695 AB0R82_RS12300 WP_003230187.1 2412148..2412321(+) (sinI) [Bacillus subtilis strain JM553]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1019695 AB0R82_RS12300 WP_003230187.1 2412148..2412321(+) (sinI) [Bacillus subtilis strain JM553]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment