Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABLU29_RS04065 Genome accession   NZ_CP157498
Coordinates   714927..715202 (+) Length   91 a.a.
NCBI ID   WP_257012268.1    Uniprot ID   -
Organism   Lactococcus lactis strain 2B-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 709927..720202
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABLU29_RS04035 (ABLU29_04025) comGA 711509..712447 (+) 939 WP_058212859.1 competence type IV pilus ATPase ComGA Machinery gene
  ABLU29_RS04040 (ABLU29_04030) comGB 712341..713414 (+) 1074 WP_406835453.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABLU29_RS04045 (ABLU29_04035) comGC 713428..713811 (+) 384 WP_010906318.1 competence type IV pilus major pilin ComGC Machinery gene
  ABLU29_RS04050 (ABLU29_04040) comGD 713786..714202 (+) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABLU29_RS04055 (ABLU29_04045) comGE 714174..714470 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABLU29_RS04060 (ABLU29_04050) comGF 714433..714879 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABLU29_RS04065 (ABLU29_04055) comGG 714927..715202 (+) 276 WP_257012268.1 hypothetical protein Machinery gene
  ABLU29_RS04070 (ABLU29_04060) - 715283..715720 (+) 438 WP_058213216.1 zinc-dependent MarR family transcriptional regulator -
  ABLU29_RS04075 (ABLU29_04065) - 715717..716559 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  ABLU29_RS04080 (ABLU29_04070) - 716736..717473 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ABLU29_RS04085 (ABLU29_04075) - 717466..718275 (+) 810 WP_014570791.1 metal ABC transporter permease -
  ABLU29_RS04090 (ABLU29_04080) - 718314..719180 (-) 867 WP_058213299.1 RluA family pseudouridine synthase -
  ABLU29_RS04095 (ABLU29_04085) - 719385..719762 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 91 a.a.        Molecular weight: 10417.58 Da        Isoelectric Point: 5.0604

>NTDB_id=1007232 ABLU29_RS04065 WP_257012268.1 714927..715202(+) (comGG) [Lactococcus lactis strain 2B-5]
MFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQFSIH
LKDGANFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=1007232 ABLU29_RS04065 WP_257012268.1 714927..715202(+) (comGG) [Lactococcus lactis strain 2B-5]
ATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACAGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATTTGTCCTACA
ATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTTAGTATCCAT
CTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.889

98.901

0.582


Multiple sequence alignment