Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXQ87_RS09800 Genome accession   NZ_CP156986
Coordinates   1991942..1992412 (-) Length   156 a.a.
NCBI ID   WP_000934760.1    Uniprot ID   A0AAN2D761
Organism   Staphylococcus aureus strain BSN68     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1962592..2009035 1991942..1992412 within 0


Gene organization within MGE regions


Location: 1962592..2009035
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXQ87_RS09585 (UXQ87_09585) scn 1962592..1962942 (-) 351 WP_000702262.1 complement inhibitor SCIN-A -
  UXQ87_RS09590 (UXQ87_09590) - 1963624..1964073 (+) 450 WP_000727645.1 chemotaxis-inhibiting protein CHIPS -
  UXQ87_RS09595 (UXQ87_09595) - 1964166..1964500 (-) 335 Protein_1850 SH3 domain-containing protein -
  UXQ87_RS09600 (UXQ87_09600) sak 1965151..1965642 (-) 492 WP_000920041.1 staphylokinase -
  UXQ87_RS09605 (UXQ87_09605) - 1965833..1966588 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  UXQ87_RS09610 (UXQ87_09610) - 1966600..1966854 (-) 255 WP_000611512.1 phage holin -
  UXQ87_RS09615 (UXQ87_09615) - 1966906..1967013 (+) 108 WP_031762631.1 hypothetical protein -
  UXQ87_RS09620 (UXQ87_09620) pepG1 1967066..1967200 (-) 135 WP_000880503.1 type I toxin-antitoxin system toxin PepG1 -
  UXQ87_RS09625 (UXQ87_09625) - 1967385..1967759 (-) 375 WP_000340977.1 hypothetical protein -
  UXQ87_RS09630 (UXQ87_09630) - 1967815..1968102 (-) 288 WP_001262620.1 hypothetical protein -
  UXQ87_RS09635 (UXQ87_09635) - 1968148..1968300 (-) 153 WP_001000058.1 hypothetical protein -
  UXQ87_RS09640 (UXQ87_09640) - 1968293..1972075 (-) 3783 WP_336222525.1 phage tail spike protein -
  UXQ87_RS09645 (UXQ87_09645) - 1972091..1973575 (-) 1485 WP_000567408.1 phage tail domain-containing protein -
  UXQ87_RS09650 (UXQ87_09650) - 1973572..1978101 (-) 4530 WP_001792924.1 phage tail tape measure protein -
  UXQ87_RS09655 (UXQ87_09655) - 1978158..1978295 (-) 138 WP_001549167.1 hypothetical protein -
  UXQ87_RS09660 (UXQ87_09660) - 1978346..1978696 (-) 351 WP_001096355.1 hypothetical protein -
  UXQ87_RS09665 (UXQ87_09665) - 1978746..1978976 (-) 231 Protein_1864 Ig-like domain-containing protein -
  UXQ87_RS09670 (UXQ87_09670) - 1979012..1979656 (-) 645 WP_336222526.1 major tail protein -
  UXQ87_RS09675 (UXQ87_09675) - 1979657..1980064 (-) 408 WP_000565498.1 hypothetical protein -
  UXQ87_RS09680 (UXQ87_09680) - 1980061..1980465 (-) 405 WP_000114226.1 HK97 gp10 family phage protein -
  UXQ87_RS09685 (UXQ87_09685) - 1980462..1980824 (-) 363 WP_000755148.1 head-tail adaptor protein -
  UXQ87_RS09690 (UXQ87_09690) - 1980808..1981092 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  UXQ87_RS09695 (UXQ87_09695) - 1981082..1981366 (-) 285 WP_000238236.1 hypothetical protein -
  UXQ87_RS09700 (UXQ87_09700) - 1981386..1982531 (-) 1146 WP_000154559.1 phage major capsid protein -
  UXQ87_RS09705 (UXQ87_09705) - 1982555..1983292 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  UXQ87_RS09710 (UXQ87_09710) - 1983276..1984463 (-) 1188 WP_000025274.1 phage portal protein -
  UXQ87_RS09715 (UXQ87_09715) - 1984479..1986140 (-) 1662 WP_000625088.1 terminase large subunit -
  UXQ87_RS09720 (UXQ87_09720) - 1986137..1986481 (-) 345 WP_000402904.1 hypothetical protein -
  UXQ87_RS09725 (UXQ87_09725) - 1986610..1986909 (-) 300 WP_000988336.1 HNH endonuclease -
  UXQ87_RS09730 (UXQ87_09730) - 1987141..1987557 (-) 417 WP_000590122.1 hypothetical protein -
  UXQ87_RS09735 (UXQ87_09735) - 1987585..1987785 (-) 201 WP_000265043.1 DUF1514 family protein -
  UXQ87_RS09740 (UXQ87_09740) - 1987785..1987934 (-) 150 WP_000595265.1 transcriptional activator RinB -
  UXQ87_RS09745 (UXQ87_09745) - 1987931..1988317 (-) 387 WP_000592207.1 hypothetical protein -
  UXQ87_RS09750 (UXQ87_09750) - 1988314..1988520 (-) 207 WP_000195803.1 DUF1381 domain-containing protein -
  UXQ87_RS09755 (UXQ87_09755) - 1988517..1988762 (-) 246 WP_001282074.1 hypothetical protein -
  UXQ87_RS09760 (UXQ87_09760) - 1988799..1989335 (-) 537 WP_001066447.1 dUTP diphosphatase -
  UXQ87_RS09765 (UXQ87_09765) - 1989328..1989498 (-) 171 WP_000714403.1 hypothetical protein -
  UXQ87_RS09770 (UXQ87_09770) - 1989485..1989739 (-) 255 WP_001065097.1 DUF1024 family protein -
  UXQ87_RS09775 (UXQ87_09775) - 1989754..1989996 (-) 243 WP_000131370.1 SAV1978 family virulence-associated passenger protein -
  UXQ87_RS09780 (UXQ87_09780) - 1990000..1990368 (-) 369 WP_000101288.1 SA1788 family PVL leukocidin-associated protein -
  UXQ87_RS09785 (UXQ87_09785) - 1990381..1990785 (-) 405 WP_000401974.1 RusA family crossover junction endodeoxyribonuclease -
  UXQ87_RS09790 (UXQ87_09790) - 1990794..1991012 (-) 219 WP_000338530.1 hypothetical protein -
  UXQ87_RS09795 (UXQ87_09795) - 1991019..1991912 (-) 894 WP_000148321.1 DnaD domain-containing protein -
  UXQ87_RS09800 (UXQ87_09800) ssbA 1991942..1992412 (-) 471 WP_000934760.1 single-stranded DNA-binding protein Machinery gene
  UXQ87_RS09805 (UXQ87_09805) - 1992413..1993030 (-) 618 WP_071665632.1 MBL fold metallo-hydrolase -
  UXQ87_RS09810 (UXQ87_09810) - 1993111..1994031 (-) 921 WP_000138475.1 recombinase RecT -
  UXQ87_RS09815 (UXQ87_09815) - 1994033..1995976 (-) 1944 WP_025173834.1 AAA family ATPase -
  UXQ87_RS09820 (UXQ87_09820) - 1995985..1996248 (-) 264 WP_001205732.1 hypothetical protein -
  UXQ87_RS09825 (UXQ87_09825) - 1996257..1996517 (-) 261 WP_000291504.1 DUF1108 family protein -
  UXQ87_RS09830 (UXQ87_09830) - 1996522..1996824 (-) 303 WP_000165364.1 DUF2482 family protein -
  UXQ87_RS09835 (UXQ87_09835) - 1996917..1997078 (-) 162 WP_000066011.1 DUF1270 domain-containing protein -
  UXQ87_RS09840 (UXQ87_09840) - 1997075..1997395 (-) 321 WP_001120936.1 DUF771 domain-containing protein -
  UXQ87_RS09845 (UXQ87_09845) - 1997545..1997643 (-) 99 Protein_1900 hypothetical protein -
  UXQ87_RS09850 (UXQ87_09850) - 1997668..1998069 (-) 402 Protein_1901 phage antirepressor KilAC domain-containing protein -
  UXQ87_RS09855 (UXQ87_09855) sph 1998067..1998879 (+) 813 Protein_1902 sphingomyelin phosphodiesterase -
  UXQ87_RS09860 (UXQ87_09860) lukG 1999117..2000133 (-) 1017 WP_000595326.1 bi-component leukocidin LukGH subunit G -
  UXQ87_RS09865 (UXQ87_09865) lukH 2000155..2001207 (-) 1053 WP_000791419.1 bi-component leukocidin LukGH subunit H -
  UXQ87_RS09870 (UXQ87_09870) - 2001643..2002866 (+) 1224 WP_000206621.1 ArgE/DapE family deacylase -
  UXQ87_RS09875 (UXQ87_09875) - 2003238..2004084 (-) 847 Protein_1906 class I SAM-dependent methyltransferase -
  UXQ87_RS09880 (UXQ87_09880) - 2004146..2005057 (-) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  UXQ87_RS09885 (UXQ87_09885) - 2005218..2006525 (+) 1308 WP_001045085.1 TrkH family potassium uptake protein -
  UXQ87_RS09890 (UXQ87_09890) groL 2007059..2008675 (-) 1617 WP_000240642.1 chaperonin GroEL -
  UXQ87_RS09895 (UXQ87_09895) groES 2008751..2009035 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1003561 UXQ87_RS09800 WP_000934760.1 1991942..1992412(-) (ssbA) [Staphylococcus aureus strain BSN68]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1003561 UXQ87_RS09800 WP_000934760.1 1991942..1992412(-) (ssbA) [Staphylococcus aureus strain BSN68]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365


Multiple sequence alignment