Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2006630..2006966 | Replicon | chromosome |
Accession | NZ_CP008816 | ||
Organism | Enterococcus faecalis ATCC 29212 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | DR75_RS10545 | Protein ID | WP_002381035.1 |
Coordinates | 2006630..2006773 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2006917..2006966 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DR75_RS10530 (DR75_1952) | 2002729..2003358 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
DR75_RS10540 (DR75_1953) | 2004051..2005667 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
DR75_RS15750 | 2005997..2006140 | + | 144 | WP_002392818.1 | putative holin-like toxin | - |
DR75_RS15755 | 2006259..2006399 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
DR75_RS10545 (DR75_1954) | 2006630..2006773 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- | 2006917..2006966 | + | 50 | - | - | Antitoxin |
DR75_RS10550 (DR75_1955) | 2006968..2011659 | - | 4692 | WP_010784674.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 1970908..2015454 | 44546 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T47616 WP_002381035.1 NZ_CP008816:2006630-2006773 [Enterococcus faecalis ATCC 29212]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
>T47616 NZ_CP008816:2006630-2006773 [Enterococcus faecalis ATCC 29212]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTAAAAGAAAACAATAAAAAATAA
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTAAAAGAAAACAATAAAAAATAA
Antitoxin
Download Length: 50 bp
>AT47616 NZ_CP008816:2006917-2006966 [Enterococcus faecalis ATCC 29212]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|