Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2842616..2842952 | Replicon | chromosome |
Accession | NZ_CP124923 | ||
Organism | Enterococcus faecalis strain EfsC11 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | QLQ48_RS13875 | Protein ID | WP_002381035.1 |
Coordinates | 2842616..2842759 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2842903..2842952 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ48_RS13855 (2838715) | 2838715..2839344 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
QLQ48_RS13860 (2840037) | 2840037..2841653 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
QLQ48_RS13865 (2841983) | 2841983..2842126 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
- (2842059) | 2842059..2842243 | - | 185 | NuclAT_8 | - | - |
- (2842100) | 2842100..2842243 | - | 144 | NuclAT_12 | - | - |
QLQ48_RS13870 (2842245) | 2842245..2842385 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
- (2842318) | 2842318..2842516 | - | 199 | NuclAT_6 | - | - |
QLQ48_RS13875 (2842616) | 2842616..2842759 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- (2842903) | 2842903..2842952 | + | 50 | NuclAT_13 | - | Antitoxin |
- (2842691) | 2842691..2842953 | - | 263 | NuclAT_10 | - | - |
QLQ48_RS13880 (2842954) | 2842954..2847645 | - | 4692 | WP_282897468.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 2806896..2851440 | 44544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T281852 WP_002381035.1 NZ_CP124923:2842616-2842759 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281852 NZ_CP124923:2842903-2842952 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|