Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2836359..2836930 | Replicon | chromosome |
Accession | NZ_CP124923 | ||
Organism | Enterococcus faecalis strain EfsC11 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QLQ48_RS13835 | Protein ID | WP_002354774.1 |
Coordinates | 2836359..2836700 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ48_RS13840 | Protein ID | WP_002354773.1 |
Coordinates | 2836700..2836930 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ48_RS13830 (2832374) | 2832374..2835988 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
QLQ48_RS13835 (2836359) | 2836359..2836700 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ48_RS13840 (2836700) | 2836700..2836930 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ48_RS13845 (2837105) | 2837105..2837320 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ48_RS13850 (2837459) | 2837459..2838451 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ48_RS13855 (2838715) | 2838715..2839344 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
QLQ48_RS13860 (2840037) | 2840037..2841653 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integrative and Conjugative Element | - | - | 2806896..2851440 | 44544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T281841 WP_002354774.1 NZ_CP124923:c2836700-2836359 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|