Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 631073..631872 | Replicon | chromosome |
Accession | NZ_LS483297 | ||
Organism | Escherichia coli strain NCTC11023 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | DQM98_RS03320 | Protein ID | WP_000347273.1 |
Coordinates | 631073..631537 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0TI39 |
Locus tag | DQM98_RS03325 | Protein ID | WP_021547164.1 |
Coordinates | 631537..631872 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM98_RS03285 | 626074..626508 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
DQM98_RS03290 | 626526..627404 | - | 879 | WP_001300474.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
DQM98_RS03295 | 627394..628173 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
DQM98_RS03300 | 628184..628657 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
DQM98_RS03305 | 628680..629960 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
DQM98_RS03315 | 630209..631018 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
DQM98_RS03320 | 631073..631537 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
DQM98_RS03325 | 631537..631872 | - | 336 | WP_021547164.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
DQM98_RS03330 | 632021..633592 | - | 1572 | WP_001753084.1 | galactarate dehydratase | - |
DQM98_RS03335 | 633967..635301 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
DQM98_RS03340 | 635317..636087 | + | 771 | WP_111732345.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 631073..642747 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T292172 WP_000347273.1 NZ_LS483297:c631537-631073 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|