Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ralRA/-
Location 1397825..1398196 Replicon chromosome
Accession NZ_LR881938
Organism Escherichia coli str. K-12 substr. MG1655 strain K-12

Toxin (Protein)


Gene name ralR Uniprot ID F4VC37
Locus tag IEU92_RS06850 Protein ID WP_001317028.1
Coordinates 1398002..1398196 (-) Length 65 a.a.

Antitoxin (RNA)


Gene name ralA
Locus tag -
Coordinates 1397825..1398003 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IEU92_RS06820 1392916..1393947 - 1032 WP_000559900.1 low conductance mechanosensitive channel YnaI -
IEU92_RS06825 1394101..1395117 + 1017 WP_010723085.1 IS5-like element IS5 family transposase -
IEU92_RS06830 1395405..1396217 - 813 Protein_1328 tRNA 2-thiocytidine(32) synthetase TtcA -
IEU92_RS06835 1396269..1397504 - 1236 WP_000040852.1 site-specific integrase -
IEU92_RS06840 1397506..1397721 - 216 WP_000079604.1 excisionase XisR -
IEU92_RS06845 1397800..1398009 - 210 WP_000276809.1 double-strand break reduction protein RcbA -
- 1397825..1398003 + 179 NuclAT_0 - Antitoxin
- 1397825..1398003 + 179 NuclAT_0 - Antitoxin
- 1397825..1398003 + 179 NuclAT_0 - Antitoxin
- 1397825..1398003 + 179 NuclAT_0 - Antitoxin
IEU92_RS06850 1398002..1398196 - 195 WP_001317028.1 type I toxin-antitoxin system endodeoxyribonuclease toxin RalR Toxin
IEU92_RS06855 1398253..1399062 - 810 WP_000166319.1 recombination protein RecT -
IEU92_RS06860 1399055..1401655 - 2601 WP_000105143.1 exodeoxyribonuclease VIII -
IEU92_RS06865 1401757..1402032 - 276 WP_000632297.1 protein RacC -
IEU92_RS06870 1402107..1402277 - 171 WP_001352098.1 conserved protein, Rac prophage -
IEU92_RS06875 1402277..1402498 - 222 WP_000560225.1 killing protein KilR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1396269..1417943 21674
flank IS/Tn - - 1394137..1395117 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Endodeoxyribonuclease toxin RalR

(6-54)


Sequences

Toxin        


Download         Length: 65 a.a.        Molecular weight: 7018.89 Da        Isoelectric Point: 8.9538

>T289509 WP_001317028.1 NZ_LR881938:c1398196-1398002 [Escherichia coli str. K-12 substr. MG1655]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV

Download         Length: 195 bp

Antitoxin


Download         Length: 179 bp

>AT289509 NZ_LR881938:1397825-1398003 [Escherichia coli str. K-12 substr. MG1655]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6LHV7

Antitoxin

Download structure file

References