Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 1397825..1398196 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | IEU92_RS06850 | Protein ID | WP_001317028.1 |
| Coordinates | 1398002..1398196 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 1397825..1398003 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS06820 | 1392916..1393947 | - | 1032 | WP_000559900.1 | low conductance mechanosensitive channel YnaI | - |
| IEU92_RS06825 | 1394101..1395117 | + | 1017 | WP_010723085.1 | IS5-like element IS5 family transposase | - |
| IEU92_RS06830 | 1395405..1396217 | - | 813 | Protein_1328 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| IEU92_RS06835 | 1396269..1397504 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| IEU92_RS06840 | 1397506..1397721 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| IEU92_RS06845 | 1397800..1398009 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| - | 1397825..1398003 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 1397825..1398003 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 1397825..1398003 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 1397825..1398003 | + | 179 | NuclAT_0 | - | Antitoxin |
| IEU92_RS06850 | 1398002..1398196 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| IEU92_RS06855 | 1398253..1399062 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| IEU92_RS06860 | 1399055..1401655 | - | 2601 | WP_000105143.1 | exodeoxyribonuclease VIII | - |
| IEU92_RS06865 | 1401757..1402032 | - | 276 | WP_000632297.1 | protein RacC | - |
| IEU92_RS06870 | 1402107..1402277 | - | 171 | WP_001352098.1 | conserved protein, Rac prophage | - |
| IEU92_RS06875 | 1402277..1402498 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1396269..1417943 | 21674 | ||
| flank | IS/Tn | - | - | 1394137..1395117 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T289509 WP_001317028.1 NZ_LR881938:c1398196-1398002 [Escherichia coli str. K-12 substr. MG1655]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT289509 NZ_LR881938:1397825-1398003 [Escherichia coli str. K-12 substr. MG1655]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|