Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | ABC806_RS00040 | Genome accession | NZ_CP155539 |
| Coordinates | 5918..6043 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 918..11043
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABC806_RS00015 (ABC806_00015) | dnaA | 1403..2764 (-) | 1362 | WP_000660618.1 | chromosomal replication initiator protein DnaA | - |
| ABC806_RS00020 (ABC806_00020) | spo0J | 2977..3735 (-) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| ABC806_RS00025 (ABC806_00025) | htrA | 3793..4974 (-) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| ABC806_RS00030 (ABC806_00030) | rlmH | 5157..5636 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ABC806_RS00040 (ABC806_00040) | comC/comC2 | 5918..6043 (+) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| ABC806_RS00045 (ABC806_00045) | comD/comD2 | 6064..7389 (+) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| ABC806_RS00050 (ABC806_00050) | comE | 7386..8138 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| ABC806_RS00065 (ABC806_00065) | - | 8381..8923 (-) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| ABC806_RS00070 (ABC806_00070) | - | 9102..10704 (+) | 1603 | Protein_10 | YhgE/Pip domain-containing protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=997532 ABC806_RS00040 WP_000799686.1 5918..6043(+) (comC/comC2) [Streptococcus pneumoniae TIGR4]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=997532 ABC806_RS00040 WP_000799686.1 5918..6043(+) (comC/comC2) [Streptococcus pneumoniae TIGR4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |