Detailed information    

insolico Bioinformatically predicted

Overview

Name   comW   Type   Regulator
Locus tag   ABC804_RS00280 Genome accession   NZ_CP155536
Coordinates   38168..38404 (-) Length   78 a.a.
NCBI ID   WP_000939546.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain M264-3     
Function   stabilization and activation of ComX (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1253..47820 38168..38404 within 0
IS/Tn 38721..38927 38168..38404 flank 317


Gene organization within MGE regions


Location: 1253..47820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC804_RS00015 (ABC804_00015) - 1253..1696 (-) 444 WP_000701992.1 dUTP diphosphatase -
  ABC804_RS00025 (ABC804_00025) tadA 1882..2349 (-) 468 WP_000291870.1 tRNA adenosine(34) deaminase TadA -
  ABC804_RS00030 (ABC804_00030) - 2917..3105 (+) 189 WP_000109850.1 hypothetical protein -
  ABC804_RS00035 (ABC804_00035) - 3326..4282 (-) 957 WP_000350505.1 N-acetylmuramoyl-L-alanine amidase family protein -
  ABC804_RS00040 (ABC804_00040) - 4286..4618 (-) 333 WP_001186219.1 phage holin -
  ABC804_RS00045 (ABC804_00045) - 4622..5038 (-) 417 WP_001165344.1 phage holin family protein -
  ABC804_RS00050 (ABC804_00050) - 5047..5397 (-) 351 WP_000852241.1 hypothetical protein -
  ABC804_RS00055 (ABC804_00055) - 5400..5603 (-) 204 WP_001091113.1 hypothetical protein -
  ABC804_RS00060 (ABC804_00060) - 5584..5700 (-) 117 WP_001063632.1 hypothetical protein -
  ABC804_RS00065 (ABC804_00065) - 5697..12329 (-) 6633 WP_000966215.1 phage tail spike protein -
  ABC804_RS00070 (ABC804_00070) - 12330..13052 (-) 723 WP_000589856.1 hypothetical protein -
  ABC804_RS00075 (ABC804_00075) - 13049..16144 (-) 3096 WP_000918318.1 hypothetical protein -
  ABC804_RS00080 (ABC804_00080) - 16422..16841 (-) 420 WP_001227146.1 hypothetical protein -
  ABC804_RS00085 (ABC804_00085) - 16853..17431 (-) 579 WP_000191279.1 major tail protein -
  ABC804_RS00090 (ABC804_00090) - 17443..17766 (-) 324 WP_000777003.1 hypothetical protein -
  ABC804_RS00095 (ABC804_00095) - 17763..18110 (-) 348 WP_000063886.1 HK97 gp10 family phage protein -
  ABC804_RS00100 (ABC804_00100) - 18107..18406 (-) 300 WP_000267055.1 phage head closure protein -
  ABC804_RS00105 (ABC804_00105) - 18393..18674 (-) 282 WP_000370976.1 hypothetical protein -
  ABC804_RS00110 (ABC804_00110) - 18677..18946 (-) 270 WP_000262606.1 hypothetical protein -
  ABC804_RS00115 (ABC804_00115) - 18958..20124 (-) 1167 WP_001030357.1 phage major capsid protein -
  ABC804_RS00120 (ABC804_00120) - 20121..20696 (-) 576 WP_001172115.1 HK97 family phage prohead protease -
  ABC804_RS00125 (ABC804_00125) - 20680..21882 (-) 1203 WP_000510803.1 phage portal protein -
  ABC804_RS00130 (ABC804_00130) - 21900..22118 (-) 219 WP_001002923.1 hypothetical protein -
  ABC804_RS00135 (ABC804_00135) - 22126..23856 (-) 1731 WP_000527299.1 terminase large subunit -
  ABC804_RS00140 (ABC804_00140) - 23849..24241 (-) 393 WP_001118283.1 P27 family phage terminase small subunit -
  ABC804_RS00145 (ABC804_00145) - 24378..24698 (-) 321 WP_000282427.1 HNH endonuclease -
  ABC804_RS00150 (ABC804_00150) - 25075..25617 (-) 543 WP_000397549.1 site-specific integrase -
  ABC804_RS00155 (ABC804_00155) - 25805..26206 (-) 402 WP_000736390.1 transcriptional activator -
  ABC804_RS00160 (ABC804_00160) - 26383..26457 (-) 75 Protein_30 DUF1642 domain-containing protein -
  ABC804_RS00165 (ABC804_00165) - 26459..26776 (-) 318 WP_000969665.1 hypothetical protein -
  ABC804_RS00170 (ABC804_00170) - 26748..26957 (-) 210 WP_000872740.1 hypothetical protein -
  ABC804_RS00175 (ABC804_00175) - 26944..27111 (-) 168 WP_000233203.1 hypothetical protein -
  ABC804_RS00180 (ABC804_00180) - 27125..27223 (-) 99 Protein_34 single-stranded DNA-binding protein -
  ABC804_RS00185 (ABC804_00185) - 27605..27823 (-) 219 WP_000891962.1 hypothetical protein -
  ABC804_RS00190 (ABC804_00190) - 27823..28017 (-) 195 WP_000470307.1 hypothetical protein -
  ABC804_RS00195 (ABC804_00195) - 28032..28802 (-) 771 WP_000228219.1 ATP-binding protein -
  ABC804_RS00200 (ABC804_00200) - 28942..29748 (-) 807 WP_001289771.1 phage replisome organizer N-terminal domain-containing protein -
  ABC804_RS00205 (ABC804_00205) - 29741..30037 (-) 297 WP_000391805.1 hypothetical protein -
  ABC804_RS00210 (ABC804_00210) - 30053..30373 (-) 321 WP_000462824.1 hypothetical protein -
  ABC804_RS00215 (ABC804_00215) - 30459..30716 (-) 258 WP_000370959.1 hypothetical protein -
  ABC804_RS00220 (ABC804_00220) - 30730..31440 (-) 711 WP_001002359.1 ORF6C domain-containing protein -
  ABC804_RS00225 (ABC804_00225) - 31494..31919 (+) 426 WP_000386249.1 hypothetical protein -
  ABC804_RS00230 (ABC804_00230) - 31914..32075 (-) 162 WP_001002946.1 hypothetical protein -
  ABC804_RS00235 (ABC804_00235) - 32086..32283 (-) 198 WP_001057654.1 hypothetical protein -
  ABC804_RS00240 (ABC804_00240) - 32300..32503 (-) 204 WP_000032097.1 helix-turn-helix transcriptional regulator -
  ABC804_RS00245 (ABC804_00245) - 32515..32661 (-) 147 WP_000389576.1 hypothetical protein -
  ABC804_RS00250 (ABC804_00250) - 32780..33001 (+) 222 WP_000041097.1 hypothetical protein -
  ABC804_RS00255 (ABC804_00255) - 33378..33743 (+) 366 WP_000492031.1 helix-turn-helix transcriptional regulator -
  ABC804_RS00260 (ABC804_00260) - 33756..34139 (+) 384 WP_000136459.1 ImmA/IrrE family metallo-endopeptidase -
  ABC804_RS00265 (ABC804_00265) - 34152..35075 (+) 924 WP_000122591.1 exonuclease domain-containing protein -
  ABC804_RS00270 (ABC804_00270) - 35261..36409 (+) 1149 WP_000876732.1 site-specific integrase -
  ABC804_RS00275 (ABC804_00275) - 36651..37937 (-) 1287 WP_000205044.1 adenylosuccinate synthase -
  ABC804_RS00280 (ABC804_00280) comW 38168..38404 (-) 237 WP_000939546.1 sigma(X)-activator ComW Regulator
  ABC804_RS00285 (ABC804_00285) - 38670..39467 (+) 798 Protein_55 transposase -
  ABC804_RS00290 (ABC804_00290) - 39502..39711 (-) 210 Protein_56 transposase -
  ABC804_RS00325 (ABC804_00325) comX/comX2 45261..45740 (-) 480 WP_000588866.1 sigma-70 family RNA polymerase sigma factor Regulator
  ABC804_RS00330 (ABC804_00330) ftsH 45862..47820 (-) 1959 WP_000744554.1 ATP-dependent zinc metalloprotease FtsH -

Sequence

Protein


Download         Length: 78 a.a.        Molecular weight: 9686.14 Da        Isoelectric Point: 6.7051

>NTDB_id=997380 ABC804_RS00280 WP_000939546.1 38168..38404(-) (comW) [Streptococcus pneumoniae strain M264-3]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=997380 ABC804_RS00280 WP_000939546.1 38168..38404(-) (comW) [Streptococcus pneumoniae strain M264-3]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comW Streptococcus pneumoniae Rx1

98.718

100

0.987
  comW Streptococcus pneumoniae D39

98.718

100

0.987
  comW Streptococcus pneumoniae R6

98.718

100

0.987
  comW Streptococcus pneumoniae TIGR4

98.718

100

0.987
  comW Streptococcus mitis SK321

76.923

100

0.769
  comW Streptococcus mitis NCTC 12261

76.623

98.718

0.756

Multiple sequence alignment