Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | ABC804_RS00280 | Genome accession | NZ_CP155536 |
| Coordinates | 38168..38404 (-) | Length | 78 a.a. |
| NCBI ID | WP_000939546.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain M264-3 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1253..47820 | 38168..38404 | within | 0 |
| IS/Tn | 38721..38927 | 38168..38404 | flank | 317 |
Gene organization within MGE regions
Location: 1253..47820
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABC804_RS00015 (ABC804_00015) | - | 1253..1696 (-) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| ABC804_RS00025 (ABC804_00025) | tadA | 1882..2349 (-) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| ABC804_RS00030 (ABC804_00030) | - | 2917..3105 (+) | 189 | WP_000109850.1 | hypothetical protein | - |
| ABC804_RS00035 (ABC804_00035) | - | 3326..4282 (-) | 957 | WP_000350505.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| ABC804_RS00040 (ABC804_00040) | - | 4286..4618 (-) | 333 | WP_001186219.1 | phage holin | - |
| ABC804_RS00045 (ABC804_00045) | - | 4622..5038 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| ABC804_RS00050 (ABC804_00050) | - | 5047..5397 (-) | 351 | WP_000852241.1 | hypothetical protein | - |
| ABC804_RS00055 (ABC804_00055) | - | 5400..5603 (-) | 204 | WP_001091113.1 | hypothetical protein | - |
| ABC804_RS00060 (ABC804_00060) | - | 5584..5700 (-) | 117 | WP_001063632.1 | hypothetical protein | - |
| ABC804_RS00065 (ABC804_00065) | - | 5697..12329 (-) | 6633 | WP_000966215.1 | phage tail spike protein | - |
| ABC804_RS00070 (ABC804_00070) | - | 12330..13052 (-) | 723 | WP_000589856.1 | hypothetical protein | - |
| ABC804_RS00075 (ABC804_00075) | - | 13049..16144 (-) | 3096 | WP_000918318.1 | hypothetical protein | - |
| ABC804_RS00080 (ABC804_00080) | - | 16422..16841 (-) | 420 | WP_001227146.1 | hypothetical protein | - |
| ABC804_RS00085 (ABC804_00085) | - | 16853..17431 (-) | 579 | WP_000191279.1 | major tail protein | - |
| ABC804_RS00090 (ABC804_00090) | - | 17443..17766 (-) | 324 | WP_000777003.1 | hypothetical protein | - |
| ABC804_RS00095 (ABC804_00095) | - | 17763..18110 (-) | 348 | WP_000063886.1 | HK97 gp10 family phage protein | - |
| ABC804_RS00100 (ABC804_00100) | - | 18107..18406 (-) | 300 | WP_000267055.1 | phage head closure protein | - |
| ABC804_RS00105 (ABC804_00105) | - | 18393..18674 (-) | 282 | WP_000370976.1 | hypothetical protein | - |
| ABC804_RS00110 (ABC804_00110) | - | 18677..18946 (-) | 270 | WP_000262606.1 | hypothetical protein | - |
| ABC804_RS00115 (ABC804_00115) | - | 18958..20124 (-) | 1167 | WP_001030357.1 | phage major capsid protein | - |
| ABC804_RS00120 (ABC804_00120) | - | 20121..20696 (-) | 576 | WP_001172115.1 | HK97 family phage prohead protease | - |
| ABC804_RS00125 (ABC804_00125) | - | 20680..21882 (-) | 1203 | WP_000510803.1 | phage portal protein | - |
| ABC804_RS00130 (ABC804_00130) | - | 21900..22118 (-) | 219 | WP_001002923.1 | hypothetical protein | - |
| ABC804_RS00135 (ABC804_00135) | - | 22126..23856 (-) | 1731 | WP_000527299.1 | terminase large subunit | - |
| ABC804_RS00140 (ABC804_00140) | - | 23849..24241 (-) | 393 | WP_001118283.1 | P27 family phage terminase small subunit | - |
| ABC804_RS00145 (ABC804_00145) | - | 24378..24698 (-) | 321 | WP_000282427.1 | HNH endonuclease | - |
| ABC804_RS00150 (ABC804_00150) | - | 25075..25617 (-) | 543 | WP_000397549.1 | site-specific integrase | - |
| ABC804_RS00155 (ABC804_00155) | - | 25805..26206 (-) | 402 | WP_000736390.1 | transcriptional activator | - |
| ABC804_RS00160 (ABC804_00160) | - | 26383..26457 (-) | 75 | Protein_30 | DUF1642 domain-containing protein | - |
| ABC804_RS00165 (ABC804_00165) | - | 26459..26776 (-) | 318 | WP_000969665.1 | hypothetical protein | - |
| ABC804_RS00170 (ABC804_00170) | - | 26748..26957 (-) | 210 | WP_000872740.1 | hypothetical protein | - |
| ABC804_RS00175 (ABC804_00175) | - | 26944..27111 (-) | 168 | WP_000233203.1 | hypothetical protein | - |
| ABC804_RS00180 (ABC804_00180) | - | 27125..27223 (-) | 99 | Protein_34 | single-stranded DNA-binding protein | - |
| ABC804_RS00185 (ABC804_00185) | - | 27605..27823 (-) | 219 | WP_000891962.1 | hypothetical protein | - |
| ABC804_RS00190 (ABC804_00190) | - | 27823..28017 (-) | 195 | WP_000470307.1 | hypothetical protein | - |
| ABC804_RS00195 (ABC804_00195) | - | 28032..28802 (-) | 771 | WP_000228219.1 | ATP-binding protein | - |
| ABC804_RS00200 (ABC804_00200) | - | 28942..29748 (-) | 807 | WP_001289771.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ABC804_RS00205 (ABC804_00205) | - | 29741..30037 (-) | 297 | WP_000391805.1 | hypothetical protein | - |
| ABC804_RS00210 (ABC804_00210) | - | 30053..30373 (-) | 321 | WP_000462824.1 | hypothetical protein | - |
| ABC804_RS00215 (ABC804_00215) | - | 30459..30716 (-) | 258 | WP_000370959.1 | hypothetical protein | - |
| ABC804_RS00220 (ABC804_00220) | - | 30730..31440 (-) | 711 | WP_001002359.1 | ORF6C domain-containing protein | - |
| ABC804_RS00225 (ABC804_00225) | - | 31494..31919 (+) | 426 | WP_000386249.1 | hypothetical protein | - |
| ABC804_RS00230 (ABC804_00230) | - | 31914..32075 (-) | 162 | WP_001002946.1 | hypothetical protein | - |
| ABC804_RS00235 (ABC804_00235) | - | 32086..32283 (-) | 198 | WP_001057654.1 | hypothetical protein | - |
| ABC804_RS00240 (ABC804_00240) | - | 32300..32503 (-) | 204 | WP_000032097.1 | helix-turn-helix transcriptional regulator | - |
| ABC804_RS00245 (ABC804_00245) | - | 32515..32661 (-) | 147 | WP_000389576.1 | hypothetical protein | - |
| ABC804_RS00250 (ABC804_00250) | - | 32780..33001 (+) | 222 | WP_000041097.1 | hypothetical protein | - |
| ABC804_RS00255 (ABC804_00255) | - | 33378..33743 (+) | 366 | WP_000492031.1 | helix-turn-helix transcriptional regulator | - |
| ABC804_RS00260 (ABC804_00260) | - | 33756..34139 (+) | 384 | WP_000136459.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABC804_RS00265 (ABC804_00265) | - | 34152..35075 (+) | 924 | WP_000122591.1 | exonuclease domain-containing protein | - |
| ABC804_RS00270 (ABC804_00270) | - | 35261..36409 (+) | 1149 | WP_000876732.1 | site-specific integrase | - |
| ABC804_RS00275 (ABC804_00275) | - | 36651..37937 (-) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| ABC804_RS00280 (ABC804_00280) | comW | 38168..38404 (-) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| ABC804_RS00285 (ABC804_00285) | - | 38670..39467 (+) | 798 | Protein_55 | transposase | - |
| ABC804_RS00290 (ABC804_00290) | - | 39502..39711 (-) | 210 | Protein_56 | transposase | - |
| ABC804_RS00325 (ABC804_00325) | comX/comX2 | 45261..45740 (-) | 480 | WP_000588866.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| ABC804_RS00330 (ABC804_00330) | ftsH | 45862..47820 (-) | 1959 | WP_000744554.1 | ATP-dependent zinc metalloprotease FtsH | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9686.14 Da Isoelectric Point: 6.7051
>NTDB_id=997380 ABC804_RS00280 WP_000939546.1 38168..38404(-) (comW) [Streptococcus pneumoniae strain M264-3]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=997380 ABC804_RS00280 WP_000939546.1 38168..38404(-) (comW) [Streptococcus pneumoniae strain M264-3]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae D39 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae R6 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae TIGR4 |
98.718 |
100 |
0.987 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |