Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | R8570_RS10835 | Genome accession | NZ_AP026932 |
| Coordinates | 2135061..2135186 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PZ900701549 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2130061..2140186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8570_RS10805 | - | 2130294..2132002 (-) | 1709 | Protein_2091 | YhgE/Pip family protein | - |
| R8570_RS10810 (PC1528_21200) | - | 2132181..2132723 (+) | 543 | WP_001863823.1 | TetR/AcrR family transcriptional regulator | - |
| R8570_RS10825 (PC1528_21210) | comE | 2132966..2133718 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R8570_RS10830 (PC1528_21220) | comD/comD2 | 2133715..2135040 (-) | 1326 | WP_000364846.1 | competence system sensor histidine kinase ComD | Regulator |
| R8570_RS10835 | comC/comC2 | 2135061..2135186 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| R8570_RS10845 (PC1528_21230) | rlmH | 2135468..2135947 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R8570_RS10850 (PC1528_21240) | htrA | 2136130..2137311 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| R8570_RS10855 (PC1528_21250) | spo0J | 2137369..2138127 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=98942 R8570_RS10835 WP_000799686.1 2135061..2135186(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701549]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=98942 R8570_RS10835 WP_000799686.1 2135061..2135186(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701549]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |