Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | R8615_RS10690 | Genome accession | NZ_AP026929 |
| Coordinates | 2080150..2080275 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain PZ900701114 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2075150..2085275
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8615_RS10660 | - | 2075488..2077091 (-) | 1604 | Protein_2063 | YhgE/Pip family protein | - |
| R8615_RS10665 (PC1101_20700) | - | 2077270..2077812 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| R8615_RS10680 (PC1101_20710) | comE | 2078055..2078807 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R8615_RS10685 (PC1101_20720) | comD/comD2 | 2078804..2080129 (-) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| R8615_RS10690 | comC/comC2 | 2080150..2080275 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| R8615_RS10700 (PC1101_20730) | rlmH | 2080557..2081036 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R8615_RS10705 (PC1101_20740) | htrA | 2081219..2082400 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| R8615_RS10710 (PC1101_20750) | spo0J | 2082458..2083216 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=98712 R8615_RS10690 WP_000799694.1 2080150..2080275(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701114]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=98712 R8615_RS10690 WP_000799694.1 2080150..2080275(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701114]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |