Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | R8623_RS10870 | Genome accession | NZ_AP026928 |
| Coordinates | 2095542..2095667 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain PZ900700406 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2090542..2100667
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8623_RS10840 | - | 2090880..2092483 (-) | 1604 | Protein_2096 | YhgE/Pip family protein | - |
| R8623_RS10845 (PC0401_20800) | - | 2092662..2093204 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| R8623_RS10860 (PC0401_20810) | comE | 2093447..2094199 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R8623_RS10865 (PC0401_20820) | comD/comD2 | 2094196..2095521 (-) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| R8623_RS10870 (PC0401_20830) | comC/comC2 | 2095542..2095667 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| R8623_RS10880 (PC0401_20840) | rlmH | 2095949..2096428 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R8623_RS10885 (PC0401_20850) | htrA | 2096611..2097792 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R8623_RS10890 (PC0401_20860) | spo0J | 2097850..2098608 (+) | 759 | WP_000410385.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=98634 R8623_RS10870 WP_000799694.1 2095542..2095667(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700406]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=98634 R8623_RS10870 WP_000799694.1 2095542..2095667(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700406]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |