Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   NST80_RS05935 Genome accession   NZ_CP152039
Coordinates   1306039..1306542 (-) Length   167 a.a.
NCBI ID   WP_342504558.1    Uniprot ID   -
Organism   Streptococcus sp. FSL K6-1323     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1271155..1329007 1306039..1306542 within 0


Gene organization within MGE regions


Location: 1271155..1329007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST80_RS05735 (NST80_05735) - 1271155..1272816 (-) 1662 WP_118172016.1 ribonuclease J -
  NST80_RS05740 (NST80_05740) - 1272996..1273754 (-) 759 WP_002883503.1 ABC transporter ATP-binding protein -
  NST80_RS05745 (NST80_05745) - 1273751..1274620 (-) 870 WP_002883493.1 branched-chain amino acid ABC transporter permease -
  NST80_RS05750 (NST80_05750) trpX 1274630..1275631 (-) 1002 WP_013990710.1 tryptophan ABC transporter substrate-binding protein -
  NST80_RS05755 (NST80_05755) - 1275768..1275989 (-) 222 WP_014633227.1 DUF4649 family protein -
  NST80_RS05760 (NST80_05760) tnpA 1276086..1276399 (+) 314 Protein_1081 IS200/IS605 family transposase -
  NST80_RS05765 (NST80_05765) - 1277198..1277443 (-) 246 Protein_1082 lysin -
  NST80_RS05770 (NST80_05770) - 1277489..1277917 (-) 429 Protein_1083 peptidoglycan amidohydrolase family protein -
  NST80_RS05775 (NST80_05775) - 1277937..1278167 (-) 231 WP_118172015.1 phage holin -
  NST80_RS05780 (NST80_05780) - 1278160..1278579 (-) 420 WP_342504529.1 phage holin family protein -
  NST80_RS05785 (NST80_05785) - 1278625..1278876 (-) 252 WP_342504530.1 hypothetical protein -
  NST80_RS05790 (NST80_05790) - 1278897..1280945 (-) 2049 WP_342504531.1 DUF859 domain-containing protein -
  NST80_RS05795 (NST80_05795) - 1280948..1283887 (-) 2940 WP_342504532.1 phage tail protein -
  NST80_RS05800 (NST80_05800) - 1283887..1285443 (-) 1557 WP_342504533.1 distal tail protein Dit -
  NST80_RS05805 (NST80_05805) - 1285449..1290413 (-) 4965 WP_342504534.1 tape measure protein -
  NST80_RS05810 (NST80_05810) - 1290634..1290987 (-) 354 WP_342504535.1 phage tail tube assembly chaperone -
  NST80_RS05815 (NST80_05815) - 1291051..1291665 (-) 615 WP_342504536.1 phage tail protein -
  NST80_RS05820 (NST80_05820) - 1291684..1292055 (-) 372 WP_342504537.1 DUF806 family protein -
  NST80_RS05825 (NST80_05825) - 1292060..1292482 (-) 423 WP_342504538.1 HK97 gp10 family phage protein -
  NST80_RS05830 (NST80_05830) - 1292489..1292839 (-) 351 WP_342504539.1 phage head closure protein -
  NST80_RS05835 (NST80_05835) - 1292839..1293153 (-) 315 WP_342504540.1 head-tail connector protein -
  NST80_RS05840 (NST80_05840) - 1293168..1294358 (-) 1191 WP_342504541.1 phage major capsid protein -
  NST80_RS05845 (NST80_05845) - 1294373..1295041 (-) 669 WP_342504542.1 head maturation protease, ClpP-related -
  NST80_RS05850 (NST80_05850) - 1295028..1296179 (-) 1152 WP_342504543.1 phage portal protein -
  NST80_RS05855 (NST80_05855) - 1296197..1296376 (-) 180 WP_342504544.1 DUF1056 family protein -
  NST80_RS05860 (NST80_05860) - 1296380..1298261 (-) 1882 Protein_1101 terminase TerL endonuclease subunit -
  NST80_RS05865 (NST80_05865) - 1298300..1299433 (-) 1134 WP_342504545.1 hypothetical protein -
  NST80_RS05870 (NST80_05870) - 1299540..1299680 (+) 141 WP_233047134.1 ribbon-helix-helix domain-containing protein -
  NST80_RS05875 (NST80_05875) - 1299692..1300153 (-) 462 WP_342504546.1 phage terminase small subunit P27 family -
  NST80_RS05880 (NST80_05880) - 1300337..1300855 (-) 519 WP_342504547.1 HNH endonuclease -
  NST80_RS05885 (NST80_05885) - 1300975..1301373 (-) 399 WP_342504548.1 DUF1492 domain-containing protein -
  NST80_RS05890 (NST80_05890) - 1301514..1302224 (-) 711 WP_342504549.1 DUF1340 domain-containing protein -
  NST80_RS05895 (NST80_05895) - 1302469..1302765 (-) 297 WP_342504550.1 DUF1372 family protein -
  NST80_RS05900 (NST80_05900) - 1302755..1303543 (-) 789 WP_342504551.1 DNA methyltransferase -
  NST80_RS05905 (NST80_05905) - 1303512..1304024 (-) 513 WP_342504552.1 helix-turn-helix domain-containing protein -
  NST80_RS05910 (NST80_05910) - 1304017..1304508 (-) 492 WP_342504553.1 DUF1642 domain-containing protein -
  NST80_RS05915 (NST80_05915) - 1304505..1304717 (-) 213 WP_342504554.1 sporulation protein Cse60 -
  NST80_RS05920 (NST80_05920) - 1304876..1305268 (-) 393 WP_342504555.1 hypothetical protein -
  NST80_RS05925 (NST80_05925) - 1305420..1305635 (-) 216 WP_342504556.1 hypothetical protein -
  NST80_RS05930 (NST80_05930) - 1305632..1306030 (-) 399 WP_342504557.1 hypothetical protein -
  NST80_RS05935 (NST80_05935) ssb 1306039..1306542 (-) 504 WP_342504558.1 single-stranded DNA-binding protein Machinery gene
  NST80_RS05940 (NST80_05940) - 1306558..1307394 (-) 837 WP_342504559.1 PD-(D/E)XK nuclease-like domain-containing protein -
  NST80_RS05945 (NST80_05945) - 1307387..1308298 (-) 912 WP_342504656.1 recombinase RecT -
  NST80_RS05950 (NST80_05950) - 1308369..1308605 (-) 237 WP_342504560.1 hypothetical protein -
  NST80_RS05955 (NST80_05955) - 1308630..1308803 (-) 174 WP_342504561.1 hypothetical protein -
  NST80_RS05960 (NST80_05960) - 1308808..1309653 (-) 846 WP_342504562.1 ATP-binding protein -
  NST80_RS05965 (NST80_05965) - 1309671..1310504 (-) 834 WP_342504563.1 DnaD domain protein -
  NST80_RS05970 (NST80_05970) - 1310627..1312441 (-) 1815 WP_342504564.1 SIALI-17 repeat-containing surface protein -
  NST80_RS05975 (NST80_05975) - 1312664..1312828 (-) 165 WP_215644256.1 hypothetical protein -
  NST80_RS05980 (NST80_05980) - 1312886..1313116 (+) 231 WP_215644255.1 hypothetical protein -
  NST80_RS05985 (NST80_05985) - 1313457..1313696 (-) 240 WP_252307175.1 excisionase -
  NST80_RS05990 (NST80_05990) - 1313702..1314253 (-) 552 WP_342504565.1 ORF6C domain-containing protein -
  NST80_RS05995 (NST80_05995) - 1314246..1315187 (-) 942 WP_342504566.1 hypothetical protein -
  NST80_RS06000 (NST80_06000) - 1315168..1315632 (-) 465 WP_342504567.1 DUF559 domain-containing protein -
  NST80_RS06005 (NST80_06005) - 1316020..1316220 (-) 201 WP_342504568.1 hypothetical protein -
  NST80_RS06010 (NST80_06010) - 1316291..1316494 (-) 204 WP_195310515.1 XRE family transcriptional regulator -
  NST80_RS06015 (NST80_06015) - 1316646..1316993 (+) 348 WP_342504569.1 helix-turn-helix transcriptional regulator -
  NST80_RS06020 (NST80_06020) - 1316995..1317882 (+) 888 WP_342504570.1 Abi family protein -
  NST80_RS06025 (NST80_06025) - 1318041..1318409 (+) 369 WP_118171972.1 ImmA/IrrE family metallo-endopeptidase -
  NST80_RS06030 (NST80_06030) - 1318411..1318884 (+) 474 WP_118171971.1 hypothetical protein -
  NST80_RS06035 (NST80_06035) - 1318943..1319161 (+) 219 WP_155214048.1 hypothetical protein -
  NST80_RS06040 (NST80_06040) - 1319381..1319575 (-) 195 WP_155214047.1 hypothetical protein -
  NST80_RS06045 (NST80_06045) - 1319772..1320944 (+) 1173 WP_342504571.1 site-specific integrase -
  NST80_RS06050 (NST80_06050) pyk 1321002..1322504 (-) 1503 WP_004182640.1 pyruvate kinase -
  NST80_RS06055 (NST80_06055) pfkA 1322575..1323594 (-) 1020 WP_049528851.1 6-phosphofructokinase -
  NST80_RS06060 (NST80_06060) - 1323689..1326799 (-) 3111 WP_118171969.1 DNA polymerase III subunit alpha -
  NST80_RS06065 (NST80_06065) leuD 1327014..1327604 (-) 591 WP_002884116.1 3-isopropylmalate dehydratase small subunit -
  NST80_RS06070 (NST80_06070) leuC 1327616..1329007 (-) 1392 WP_013990716.1 3-isopropylmalate dehydratase large subunit -

Sequence

Protein


Download         Length: 167 a.a.        Molecular weight: 18419.28 Da        Isoelectric Point: 4.9008

>NTDB_id=986327 NST80_RS05935 WP_342504558.1 1306039..1306542(-) (ssb) [Streptococcus sp. FSL K6-1323]
MINNVVLVGRMTRDAELKYTGNNIAVATFSLAVNRNFKDANGERETDFINCVIWRQQAENLANWAKKGALIGITGRIQTR
SYENQQGQRVYVTEVVAENFQMLESRAAREGSNASQGNTSGAFGNDNGYAGPYGQQAPQQQGPNFARDNSPYGNSNPMDI
TDDMLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=986327 NST80_RS05935 WP_342504558.1 1306039..1306542(-) (ssb) [Streptococcus sp. FSL K6-1323]
TTGATTAATAACGTTGTATTAGTTGGTCGTATGACCAGAGACGCAGAACTTAAATACACTGGAAATAACATTGCAGTAGC
TACGTTTAGCCTAGCTGTTAACCGCAATTTCAAAGACGCCAACGGTGAACGTGAAACAGACTTTATTAACTGTGTTATCT
GGCGTCAGCAAGCCGAGAATTTGGCTAATTGGGCTAAAAAAGGCGCATTGATTGGAATCACTGGACGCATTCAGACCCGT
AGCTACGAGAATCAGCAAGGTCAACGAGTGTATGTAACTGAGGTAGTCGCTGAGAACTTCCAAATGTTGGAGAGCCGTGC
AGCGCGTGAAGGTAGCAACGCCAGCCAAGGCAATACATCGGGAGCATTTGGCAATGACAACGGCTATGCAGGACCTTACG
GGCAACAAGCACCGCAACAGCAAGGACCAAACTTTGCAAGAGATAACAGCCCATACGGGAACAGTAACCCAATGGATATC
ACGGATGATATGCTACCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.322

100

0.587
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.545

100

0.575

Multiple sequence alignment