Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ABXG87_RS09390 Genome accession   NZ_AP031488
Coordinates   1981938..1982168 (-) Length   76 a.a.
NCBI ID   WP_045769382.1    Uniprot ID   -
Organism   Streptococcus salivarius strain NBRC 13956     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1976938..1987168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXG87_RS09355 (Ssa13956_17810) - 1977328..1977774 (-) 447 WP_353551574.1 CAAX protease -
  ABXG87_RS09360 (Ssa13956_17820) - 1977852..1978508 (-) 657 WP_353551575.1 type II CAAX endopeptidase family protein -
  ABXG87_RS09365 (Ssa13956_17830) - 1978520..1978717 (-) 198 WP_049553950.1 helix-turn-helix transcriptional regulator -
  ABXG87_RS09370 (Ssa13956_17840) - 1978968..1980161 (-) 1194 WP_070838927.1 acetate kinase -
  ABXG87_RS09375 (Ssa13956_17850) comGH 1980218..1981174 (-) 957 WP_353551577.1 class I SAM-dependent methyltransferase Machinery gene
  ABXG87_RS09380 (Ssa13956_17860) comGG 1981219..1981536 (-) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABXG87_RS09385 (Ssa13956_17870) comGF 1981514..1981951 (-) 438 WP_045769383.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABXG87_RS09390 (Ssa13956_17880) comGE 1981938..1982168 (-) 231 WP_045769382.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABXG87_RS09395 (Ssa13956_17890) comGD 1982200..1982628 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABXG87_RS09400 (Ssa13956_17900) comGC 1982588..1982902 (-) 315 WP_171963490.1 competence type IV pilus major pilin ComGC Machinery gene
  ABXG87_RS09405 (Ssa13956_17910) comGB 1982911..1984011 (-) 1101 WP_118185904.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABXG87_RS09410 (Ssa13956_17920) comGA 1983893..1984834 (-) 942 WP_013991268.1 competence type IV pilus ATPase ComGA Machinery gene
  ABXG87_RS09415 (Ssa13956_17930) - 1984914..1985276 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8429.85 Da        Isoelectric Point: 10.4655

>NTDB_id=98144 ABXG87_RS09390 WP_045769382.1 1981938..1982168(-) (comGE) [Streptococcus salivarius strain NBRC 13956]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGITVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=98144 ABXG87_RS09390 WP_045769382.1 1981938..1982168(-) (comGE) [Streptococcus salivarius strain NBRC 13956]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACTAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAACAAGGTATCACGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368


Multiple sequence alignment