Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | R8522_RS11425 | Genome accession | NZ_AP026916 |
| Coordinates | 2224605..2224730 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PZ900700006 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2219605..2229730
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8522_RS11405 (PC0006_22560) | adcR | 2221005..2221445 (+) | 441 | WP_001249309.1 | zinc-dependent transcriptional regulator AdcR | - |
| R8522_RS11410 (PC0006_22570) | - | 2221445..2222149 (+) | 705 | WP_001269488.1 | metal ABC transporter ATP-binding protein | - |
| R8522_RS11415 (PC0006_22580) | - | 2222142..2222948 (+) | 807 | WP_000950018.1 | metal ABC transporter permease | - |
| R8522_RS11420 (PC0006_22590) | adcA | 2222958..2224463 (+) | 1506 | WP_050123039.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
| R8522_RS11425 | comC/comC2 | 2224605..2224730 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| R8522_RS11435 (PC0006_22600) | rlmH | 2225012..2225491 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R8522_RS11440 (PC0006_22610) | htrA | 2225674..2226855 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R8522_RS11445 (PC0006_22620) | spo0J | 2226913..2227671 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=97689 R8522_RS11425 WP_000799686.1 2224605..2224730(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700006]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=97689 R8522_RS11425 WP_000799686.1 2224605..2224730(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700006]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |