Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   SOZ35_RS16630 Genome accession   NZ_CP150480
Coordinates   3275768..3275911 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain TL401     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3270768..3280911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SOZ35_RS16605 (SOZ35_16605) - 3271090..3271470 (-) 381 WP_340639773.1 hotdog fold thioesterase -
  SOZ35_RS16610 (SOZ35_16610) comA 3271488..3272129 (-) 642 WP_340639774.1 response regulator transcription factor Regulator
  SOZ35_RS16615 (SOZ35_16615) comP 3272210..3274516 (-) 2307 WP_106033958.1 two-component system sensor histidine kinase ComP Regulator
  SOZ35_RS16620 (SOZ35_16620) comX 3274530..3274697 (-) 168 WP_106033957.1 competence pheromone ComX Regulator
  SOZ35_RS16625 (SOZ35_16625) comQ 3274681..3275583 (-) 903 WP_106034023.1 polyprenyl synthetase family protein Regulator
  SOZ35_RS16630 (SOZ35_16630) degQ 3275768..3275911 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  SOZ35_RS16635 (SOZ35_16635) - 3276371..3276730 (+) 360 WP_327851480.1 hypothetical protein -
  SOZ35_RS16640 (SOZ35_16640) - 3276749..3277981 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  SOZ35_RS16645 (SOZ35_16645) - 3278119..3279585 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  SOZ35_RS16650 (SOZ35_16650) - 3279601..3280152 (-) 552 WP_063637896.1 isochorismatase family cysteine hydrolase -
  SOZ35_RS16655 (SOZ35_16655) - 3280260..3280658 (-) 399 WP_063637897.1 YueI family protein -

Sequence


Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=970512 SOZ35_RS16630 WP_003327149.1 3275768..3275911(-) (degQ) [Bacillus atrophaeus strain TL401]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=970512 SOZ35_RS16630 WP_003327149.1 3275768..3275911(-) (degQ) [Bacillus atrophaeus strain TL401]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-47)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894


Multiple sequence alignment