Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MKX38_RS12115 Genome accession   NZ_CP150258
Coordinates   2372833..2373216 (-) Length   127 a.a.
NCBI ID   WP_327847410.1    Uniprot ID   -
Organism   Bacillus sp. FSL M8-0025     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2367833..2378216
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX38_RS12075 (MKX38_12075) sinI 2368766..2368939 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKX38_RS12080 (MKX38_12080) sinR 2368973..2369308 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKX38_RS12085 (MKX38_12085) tasA 2369401..2370186 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKX38_RS12090 (MKX38_12090) - 2370250..2370822 (-) 573 WP_003246088.1 signal peptidase I -
  MKX38_RS12095 (MKX38_12095) tapA 2370806..2371567 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKX38_RS12100 (MKX38_12100) - 2371839..2372165 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKX38_RS12105 (MKX38_12105) - 2372207..2372386 (-) 180 WP_029726723.1 YqzE family protein -
  MKX38_RS12110 (MKX38_12110) comGG 2372458..2372832 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKX38_RS12115 (MKX38_12115) comGF 2372833..2373216 (-) 384 WP_327847410.1 ComG operon protein ComGF Machinery gene
  MKX38_RS12120 (MKX38_12120) comGE 2373242..2373589 (-) 348 WP_086344081.1 ComG operon protein 5 Machinery gene
  MKX38_RS12125 (MKX38_12125) comGD 2373573..2374004 (-) 432 WP_086344082.1 comG operon protein ComGD Machinery gene
  MKX38_RS12130 (MKX38_12130) comGC 2373994..2374290 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MKX38_RS12135 (MKX38_12135) comGB 2374304..2375341 (-) 1038 WP_339187254.1 comG operon protein ComGB Machinery gene
  MKX38_RS12140 (MKX38_12140) comGA 2375328..2376398 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MKX38_RS12145 (MKX38_12145) - 2376610..2376807 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MKX38_RS12150 (MKX38_12150) corA 2376809..2377762 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14414.53 Da        Isoelectric Point: 6.7497

>NTDB_id=968311 MKX38_RS12115 WP_327847410.1 2372833..2373216(-) (comGF) [Bacillus sp. FSL M8-0025]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLTCTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIQSENQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=968311 MKX38_RS12115 WP_327847410.1 2372833..2373216(-) (comGF) [Bacillus sp. FSL M8-0025]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAACCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTCA
GAGTGAGAACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.032

99.213

0.953


Multiple sequence alignment