Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKX38_RS12075 Genome accession   NZ_CP150258
Coordinates   2368766..2368939 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL M8-0025     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2363766..2373939
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX38_RS12060 (MKX38_12060) gcvT 2364565..2365653 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  MKX38_RS12065 (MKX38_12065) - 2366095..2367768 (+) 1674 WP_004398544.1 SNF2-related protein -
  MKX38_RS12070 (MKX38_12070) - 2367789..2368583 (+) 795 WP_003230200.1 YqhG family protein -
  MKX38_RS12075 (MKX38_12075) sinI 2368766..2368939 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKX38_RS12080 (MKX38_12080) sinR 2368973..2369308 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKX38_RS12085 (MKX38_12085) tasA 2369401..2370186 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKX38_RS12090 (MKX38_12090) - 2370250..2370822 (-) 573 WP_003246088.1 signal peptidase I -
  MKX38_RS12095 (MKX38_12095) tapA 2370806..2371567 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKX38_RS12100 (MKX38_12100) - 2371839..2372165 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKX38_RS12105 (MKX38_12105) - 2372207..2372386 (-) 180 WP_029726723.1 YqzE family protein -
  MKX38_RS12110 (MKX38_12110) comGG 2372458..2372832 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKX38_RS12115 (MKX38_12115) comGF 2372833..2373216 (-) 384 WP_327847410.1 ComG operon protein ComGF Machinery gene
  MKX38_RS12120 (MKX38_12120) comGE 2373242..2373589 (-) 348 WP_086344081.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=968308 MKX38_RS12075 WP_003230187.1 2368766..2368939(+) (sinI) [Bacillus sp. FSL M8-0025]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=968308 MKX38_RS12075 WP_003230187.1 2368766..2368939(+) (sinI) [Bacillus sp. FSL M8-0025]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment