Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   WKI54_RS20435 Genome accession   NZ_CP149648
Coordinates   3968733..3969110 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain MJ04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3963733..3974110
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI54_RS20395 (WKI54_20395) - 3964230..3965024 (+) 795 WP_014305407.1 YqhG family protein -
  WKI54_RS20400 (WKI54_20400) sinI 3965201..3965374 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI54_RS20405 (WKI54_20405) sinR 3965408..3965743 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI54_RS20410 (WKI54_20410) - 3965791..3966576 (-) 786 WP_017418136.1 TasA family protein -
  WKI54_RS20415 (WKI54_20415) - 3966641..3967225 (-) 585 WP_012117977.1 signal peptidase I -
  WKI54_RS20420 (WKI54_20420) tapA 3967197..3967868 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WKI54_RS20425 (WKI54_20425) - 3968127..3968456 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI54_RS20430 (WKI54_20430) - 3968497..3968676 (-) 180 WP_003153093.1 YqzE family protein -
  WKI54_RS20435 (WKI54_20435) comGG 3968733..3969110 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI54_RS20440 (WKI54_20440) comGF 3969111..3969506 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI54_RS20445 (WKI54_20445) comGE 3969520..3969834 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI54_RS20450 (WKI54_20450) comGD 3969818..3970255 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WKI54_RS20455 (WKI54_20455) comGC 3970245..3970553 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  WKI54_RS20460 (WKI54_20460) comGB 3970558..3971595 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  WKI54_RS20465 (WKI54_20465) comGA 3971582..3972652 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  WKI54_RS20470 (WKI54_20470) - 3972844..3973794 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=960305 WKI54_RS20435 WP_017418138.1 3968733..3969110(-) (comGG) [Bacillus velezensis strain MJ04]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=960305 WKI54_RS20435 WP_017418138.1 3968733..3969110(-) (comGG) [Bacillus velezensis strain MJ04]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512