Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WKI54_RS20400 Genome accession   NZ_CP149648
Coordinates   3965201..3965374 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain MJ04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3960201..3970374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI54_RS20385 (WKI54_20385) gcvT 3961014..3962114 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  WKI54_RS20390 (WKI54_20390) - 3962538..3964208 (+) 1671 WP_257988702.1 DEAD/DEAH box helicase -
  WKI54_RS20395 (WKI54_20395) - 3964230..3965024 (+) 795 WP_014305407.1 YqhG family protein -
  WKI54_RS20400 (WKI54_20400) sinI 3965201..3965374 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI54_RS20405 (WKI54_20405) sinR 3965408..3965743 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI54_RS20410 (WKI54_20410) - 3965791..3966576 (-) 786 WP_017418136.1 TasA family protein -
  WKI54_RS20415 (WKI54_20415) - 3966641..3967225 (-) 585 WP_012117977.1 signal peptidase I -
  WKI54_RS20420 (WKI54_20420) tapA 3967197..3967868 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WKI54_RS20425 (WKI54_20425) - 3968127..3968456 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI54_RS20430 (WKI54_20430) - 3968497..3968676 (-) 180 WP_003153093.1 YqzE family protein -
  WKI54_RS20435 (WKI54_20435) comGG 3968733..3969110 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI54_RS20440 (WKI54_20440) comGF 3969111..3969506 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI54_RS20445 (WKI54_20445) comGE 3969520..3969834 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI54_RS20450 (WKI54_20450) comGD 3969818..3970255 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=960303 WKI54_RS20400 WP_014418369.1 3965201..3965374(+) (sinI) [Bacillus velezensis strain MJ04]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=960303 WKI54_RS20400 WP_014418369.1 3965201..3965374(+) (sinI) [Bacillus velezensis strain MJ04]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719