Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WKI54_RS20400 | Genome accession | NZ_CP149648 |
| Coordinates | 3965201..3965374 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain MJ04 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3960201..3970374
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WKI54_RS20385 (WKI54_20385) | gcvT | 3961014..3962114 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WKI54_RS20390 (WKI54_20390) | - | 3962538..3964208 (+) | 1671 | WP_257988702.1 | DEAD/DEAH box helicase | - |
| WKI54_RS20395 (WKI54_20395) | - | 3964230..3965024 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| WKI54_RS20400 (WKI54_20400) | sinI | 3965201..3965374 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| WKI54_RS20405 (WKI54_20405) | sinR | 3965408..3965743 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| WKI54_RS20410 (WKI54_20410) | - | 3965791..3966576 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| WKI54_RS20415 (WKI54_20415) | - | 3966641..3967225 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| WKI54_RS20420 (WKI54_20420) | tapA | 3967197..3967868 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WKI54_RS20425 (WKI54_20425) | - | 3968127..3968456 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| WKI54_RS20430 (WKI54_20430) | - | 3968497..3968676 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| WKI54_RS20435 (WKI54_20435) | comGG | 3968733..3969110 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| WKI54_RS20440 (WKI54_20440) | comGF | 3969111..3969506 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| WKI54_RS20445 (WKI54_20445) | comGE | 3969520..3969834 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| WKI54_RS20450 (WKI54_20450) | comGD | 3969818..3970255 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=960303 WKI54_RS20400 WP_014418369.1 3965201..3965374(+) (sinI) [Bacillus velezensis strain MJ04]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=960303 WKI54_RS20400 WP_014418369.1 3965201..3965374(+) (sinI) [Bacillus velezensis strain MJ04]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |