Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | QMM27_RS10325 | Genome accession | NZ_AP025939 |
| Coordinates | 2030238..2030363 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain Utah_35B-24 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2025238..2035363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM27_RS10295 | - | 2025619..2027230 (-) | 1612 | Protein_2000 | YhgE/Pip domain-containing protein | - |
| QMM27_RS10300 (Utah35B_19990) | - | 2027358..2027900 (+) | 543 | WP_001158263.1 | TetR/AcrR family transcriptional regulator | - |
| QMM27_RS10315 (Utah35B_20000) | comE | 2028143..2028895 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| QMM27_RS10320 (Utah35B_20010) | comD/comD2 | 2028892..2030217 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| QMM27_RS10325 | comC/comC2 | 2030238..2030363 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| QMM27_RS10335 (Utah35B_20020) | rlmH | 2030645..2031124 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| QMM27_RS10340 (Utah35B_20030) | htrA | 2031307..2032488 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| QMM27_RS10345 (Utah35B_20040) | spo0J | 2032546..2033304 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=95481 QMM27_RS10325 WP_000799686.1 2030238..2030363(-) (comC/comC2) [Streptococcus pneumoniae strain Utah_35B-24]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=95481 QMM27_RS10325 WP_000799686.1 2030238..2030363(-) (comC/comC2) [Streptococcus pneumoniae strain Utah_35B-24]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |