Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | QMM10_RS10530 | Genome accession | NZ_AP025938 |
| Coordinates | 2076385..2076510 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PZ900701057 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2071385..2081510
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM10_RS10500 | - | 2071766..2073377 (-) | 1612 | Protein_2037 | YhgE/Pip domain-containing protein | - |
| QMM10_RS10505 (PC1044_20300) | - | 2073505..2074047 (+) | 543 | WP_001158263.1 | TetR/AcrR family transcriptional regulator | - |
| QMM10_RS10520 (PC1044_20310) | comE | 2074290..2075042 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| QMM10_RS10525 (PC1044_20320) | comD/comD2 | 2075039..2076364 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| QMM10_RS10530 | comC/comC2 | 2076385..2076510 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| QMM10_RS10540 (PC1044_20330) | rlmH | 2076792..2077271 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| QMM10_RS10545 (PC1044_20340) | htrA | 2077454..2078635 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| QMM10_RS10550 (PC1044_20350) | spo0J | 2078693..2079451 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=95403 QMM10_RS10530 WP_000799686.1 2076385..2076510(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701057]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=95403 QMM10_RS10530 WP_000799686.1 2076385..2076510(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900701057]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |