Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   V3434_RS00750 Genome accession   NZ_CP144271
Coordinates   131195..131665 (-) Length   156 a.a.
NCBI ID   WP_024937184.1    Uniprot ID   -
Organism   Staphylococcus aureus strain LA31     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 102256..154162 131195..131665 within 0


Gene organization within MGE regions


Location: 102256..154162
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3434_RS00545 (V3434_00545) scn 102256..102606 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  V3434_RS00550 (V3434_00550) - 103117..103452 (-) 336 Protein_104 SH3 domain-containing protein -
  V3434_RS00555 (V3434_00555) sak 104103..104594 (-) 492 WP_031865878.1 staphylokinase -
  V3434_RS00560 (V3434_00560) - 104785..105540 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  V3434_RS00565 (V3434_00565) - 105552..105806 (-) 255 WP_000611512.1 phage holin -
  V3434_RS00570 (V3434_00570) - 105858..105965 (+) 108 WP_001791821.1 hypothetical protein -
  V3434_RS00575 (V3434_00575) pepG1 106018..106152 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  V3434_RS00580 (V3434_00580) - 106344..106640 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  V3434_RS00585 (V3434_00585) - 106698..106985 (-) 288 WP_001040261.1 hypothetical protein -
  V3434_RS00590 (V3434_00590) - 107032..107184 (-) 153 WP_001153681.1 hypothetical protein -
  V3434_RS00595 (V3434_00595) - 107174..110959 (-) 3786 WP_000582158.1 phage tail spike protein -
  V3434_RS00600 (V3434_00600) - 110975..112459 (-) 1485 WP_000567408.1 phage tail domain-containing protein -
  V3434_RS00605 (V3434_00605) - 112456..116985 (-) 4530 WP_350948803.1 phage tail tape measure protein -
  V3434_RS00610 (V3434_00610) - 117042..117176 (-) 135 WP_000364140.1 hypothetical protein -
  V3434_RS00615 (V3434_00615) - 117230..117580 (-) 351 WP_001096355.1 hypothetical protein -
  V3434_RS00620 (V3434_00620) - 117630..117860 (-) 231 Protein_118 Ig-like domain-containing protein -
  V3434_RS00625 (V3434_00625) - 117896..118540 (-) 645 WP_000268741.1 major tail protein -
  V3434_RS00630 (V3434_00630) - 118541..118948 (-) 408 WP_000565498.1 hypothetical protein -
  V3434_RS00635 (V3434_00635) - 118945..119349 (-) 405 WP_000114225.1 HK97 gp10 family phage protein -
  V3434_RS00640 (V3434_00640) - 119346..119708 (-) 363 WP_000755150.1 head-tail adaptor protein -
  V3434_RS00645 (V3434_00645) - 119692..119976 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  V3434_RS00650 (V3434_00650) - 119966..120250 (-) 285 WP_000238236.1 hypothetical protein -
  V3434_RS00655 (V3434_00655) - 120270..121415 (-) 1146 WP_000154555.1 phage major capsid protein -
  V3434_RS00660 (V3434_00660) - 121439..122176 (-) 738 WP_000861914.1 head maturation protease, ClpP-related -
  V3434_RS00665 (V3434_00665) - 122160..123347 (-) 1188 WP_054104817.1 phage portal protein -
  V3434_RS00670 (V3434_00670) - 123363..125024 (-) 1662 WP_000625088.1 terminase large subunit -
  V3434_RS00675 (V3434_00675) - 125021..125365 (-) 345 WP_000402904.1 hypothetical protein -
  V3434_RS00680 (V3434_00680) - 125496..125795 (-) 300 WP_000988336.1 HNH endonuclease -
  V3434_RS00685 (V3434_00685) - 126027..126443 (-) 417 WP_000590126.1 hypothetical protein -
  V3434_RS00690 (V3434_00690) - 126471..126671 (-) 201 WP_000265041.1 DUF1514 family protein -
  V3434_RS00695 (V3434_00695) - 126671..126820 (-) 150 WP_000595265.1 transcriptional activator RinB -
  V3434_RS00700 (V3434_00700) - 126817..127023 (-) 207 WP_000195820.1 DUF1381 domain-containing protein -
  V3434_RS00705 (V3434_00705) - 127060..127596 (-) 537 WP_001066444.1 dUTPase -
  V3434_RS00710 (V3434_00710) - 127589..127999 (-) 411 WP_000197967.1 hypothetical protein -
  V3434_RS00715 (V3434_00715) - 128176..128505 (-) 330 WP_350948841.1 acetyltransferase -
  V3434_RS00720 (V3434_00720) - 128502..128951 (-) 450 WP_000982711.1 YopX family protein -
  V3434_RS00725 (V3434_00725) - 129016..129258 (-) 243 WP_350948844.1 SAV1978 family virulence-associated passenger protein -
  V3434_RS00730 (V3434_00730) - 129262..129630 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  V3434_RS00735 (V3434_00735) - 129643..130047 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  V3434_RS00740 (V3434_00740) - 130056..130274 (-) 219 WP_000338528.1 hypothetical protein -
  V3434_RS00745 (V3434_00745) - 130281..131165 (-) 885 WP_016047539.1 DnaD domain protein -
  V3434_RS00750 (V3434_00750) ssbA 131195..131665 (-) 471 WP_024937184.1 single-stranded DNA-binding protein Machinery gene
  V3434_RS00755 (V3434_00755) - 131666..132283 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  V3434_RS00760 (V3434_00760) - 132364..133284 (-) 921 WP_000138481.1 recombinase RecT -
  V3434_RS00765 (V3434_00765) - 133286..135229 (-) 1944 WP_000700562.1 AAA family ATPase -
  V3434_RS00770 (V3434_00770) - 135238..135501 (-) 264 WP_001205732.1 hypothetical protein -
  V3434_RS00775 (V3434_00775) - 135510..135770 (-) 261 WP_031824013.1 DUF1108 family protein -
  V3434_RS00780 (V3434_00780) - 135775..136077 (-) 303 WP_000165371.1 DUF2482 family protein -
  V3434_RS00785 (V3434_00785) - 136172..136333 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  V3434_RS00790 (V3434_00790) - 136330..136650 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  V3434_RS00795 (V3434_00795) - 136705..137085 (+) 381 WP_000762521.1 DUF2513 domain-containing protein -
  V3434_RS00800 (V3434_00800) - 137072..137269 (-) 198 WP_001148862.1 hypothetical protein -
  V3434_RS00805 (V3434_00805) - 137285..138040 (-) 756 WP_001148342.1 phage antirepressor KilAC domain-containing protein -
  V3434_RS00810 (V3434_00810) - 138097..138635 (+) 539 Protein_156 hypothetical protein -
  V3434_RS00815 (V3434_00815) - 138659..138919 (-) 261 WP_000435341.1 transcriptional regulator -
  V3434_RS00820 (V3434_00820) - 138932..139174 (-) 243 WP_000639926.1 DUF739 family protein -
  V3434_RS00825 (V3434_00825) - 139338..140054 (+) 717 WP_001083975.1 LexA family transcriptional regulator -
  V3434_RS00830 (V3434_00830) - 140066..140920 (+) 855 WP_001557601.1 HIRAN domain-containing protein -
  V3434_RS00835 (V3434_00835) - 140994..141140 (+) 147 WP_000345949.1 hypothetical protein -
  V3434_RS00840 (V3434_00840) - 141137..141322 (+) 186 WP_000100503.1 hypothetical protein -
  V3434_RS00845 (V3434_00845) - 141522..141704 (+) 183 WP_000705240.1 hypothetical protein -
  V3434_RS00850 (V3434_00850) - 141782..142495 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  V3434_RS00855 (V3434_00855) - 142686..143723 (+) 1038 WP_000857198.1 site-specific integrase -
  V3434_RS00860 (V3434_00860) sph 143774..144604 (+) 831 Protein_166 sphingomyelin phosphodiesterase -
  V3434_RS00865 (V3434_00865) - 144866..145882 (-) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  V3434_RS00870 (V3434_00870) - 145904..146959 (-) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  V3434_RS00875 (V3434_00875) - 147391..148614 (+) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  V3434_RS00880 (V3434_00880) - 148997..150304 (+) 1308 WP_001045074.1 potassium transporter TrkG -
  V3434_RS00885 (V3434_00885) - 150843..151469 (-) 627 WP_031775879.1 hypothetical protein -
  V3434_RS00890 (V3434_00890) - 151466..151645 (-) 180 WP_000201398.1 hypothetical protein -
  V3434_RS00895 (V3434_00895) groL 152186..153802 (-) 1617 WP_000240642.1 chaperonin GroEL -
  V3434_RS00900 (V3434_00900) groES 153878..154162 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17673.56 Da        Isoelectric Point: 4.9628

>NTDB_id=933138 V3434_RS00750 WP_024937184.1 131195..131665(-) (ssbA) [Staphylococcus aureus strain LA31]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDVYQQQVQQTRGQSQYPYNKPVKDNPFANANGPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=933138 V3434_RS00750 WP_024937184.1 131195..131665(-) (ssbA) [Staphylococcus aureus strain LA31]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATGTATATCAACAACAAGTACAACAAACACGTGGGCAATCGCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCAAATGCTAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.497

100

0.641
  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Neisseria meningitidis MC58

33.526

100

0.372
  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372