Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SGQ77_RS10105 | Genome accession | NZ_CP138886 |
| Coordinates | 2044530..2045000 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610650.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 1061 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2016044..2073064 | 2044530..2045000 | within | 0 |
Gene organization within MGE regions
Location: 2016044..2073064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGQ77_RS09910 (SGQ77_09910) | scn | 2016044..2016394 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SGQ77_RS09915 (SGQ77_09915) | - | 2017077..2017526 (+) | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| SGQ77_RS09920 (SGQ77_09920) | - | 2017619..2017953 (-) | 335 | Protein_1915 | SH3 domain-containing protein | - |
| SGQ77_RS09925 (SGQ77_09925) | sak | 2018604..2019095 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| SGQ77_RS09930 (SGQ77_09930) | - | 2019286..2020041 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SGQ77_RS09935 (SGQ77_09935) | - | 2020053..2020307 (-) | 255 | WP_000611512.1 | phage holin | - |
| SGQ77_RS09940 (SGQ77_09940) | - | 2020359..2020466 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SGQ77_RS09945 (SGQ77_09945) | pepG1 | 2020519..2020653 (-) | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SGQ77_RS09950 (SGQ77_09950) | - | 2020847..2021143 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SGQ77_RS09955 (SGQ77_09955) | - | 2021201..2021488 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SGQ77_RS09960 (SGQ77_09960) | - | 2021535..2021687 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| SGQ77_RS09965 (SGQ77_09965) | - | 2021677..2025462 (-) | 3786 | WP_000582149.1 | phage tail spike protein | - |
| SGQ77_RS09970 (SGQ77_09970) | - | 2025478..2026962 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| SGQ77_RS09975 (SGQ77_09975) | - | 2026959..2031488 (-) | 4530 | WP_001805631.1 | phage tail tape measure protein | - |
| SGQ77_RS09980 (SGQ77_09980) | - | 2031545..2031682 (-) | 138 | WP_353058782.1 | hypothetical protein | - |
| SGQ77_RS09985 (SGQ77_09985) | - | 2031733..2032083 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SGQ77_RS09990 (SGQ77_09990) | - | 2032133..2032363 (-) | 231 | Protein_1929 | Ig-like domain-containing protein | - |
| SGQ77_RS09995 (SGQ77_09995) | - | 2032399..2033043 (-) | 645 | WP_000268739.1 | major tail protein | - |
| SGQ77_RS10000 (SGQ77_10000) | - | 2033044..2033451 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SGQ77_RS10005 (SGQ77_10005) | - | 2033448..2033852 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SGQ77_RS10010 (SGQ77_10010) | - | 2033849..2034211 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SGQ77_RS10015 (SGQ77_10015) | - | 2034195..2034479 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SGQ77_RS10020 (SGQ77_10020) | - | 2034469..2034753 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SGQ77_RS10025 (SGQ77_10025) | - | 2034773..2035918 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SGQ77_RS10030 (SGQ77_10030) | - | 2035942..2036679 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| SGQ77_RS10035 (SGQ77_10035) | - | 2036663..2037850 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SGQ77_RS10040 (SGQ77_10040) | - | 2037866..2039527 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SGQ77_RS10045 (SGQ77_10045) | - | 2039524..2039868 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SGQ77_RS10050 (SGQ77_10050) | - | 2039999..2040298 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SGQ77_RS10055 (SGQ77_10055) | - | 2040530..2040946 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SGQ77_RS10060 (SGQ77_10060) | - | 2040974..2041174 (-) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| SGQ77_RS10065 (SGQ77_10065) | - | 2041294..2041548 (-) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| SGQ77_RS10070 (SGQ77_10070) | - | 2041541..2041825 (-) | 285 | WP_001105620.1 | hypothetical protein | - |
| SGQ77_RS10075 (SGQ77_10075) | - | 2041822..2042271 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| SGQ77_RS10080 (SGQ77_10080) | - | 2042336..2042584 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| SGQ77_RS10085 (SGQ77_10085) | - | 2042585..2042956 (-) | 372 | WP_000101268.1 | SA1788 family PVL leukocidin-associated protein | - |
| SGQ77_RS10090 (SGQ77_10090) | - | 2042969..2043373 (-) | 405 | WP_000401976.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGQ77_RS10095 (SGQ77_10095) | - | 2043382..2043600 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SGQ77_RS10100 (SGQ77_10100) | - | 2043607..2044500 (-) | 894 | WP_000148326.1 | DnaD domain-containing protein | - |
| SGQ77_RS10105 (SGQ77_10105) | ssbA | 2044530..2045000 (-) | 471 | WP_000610650.1 | single-stranded DNA-binding protein | Machinery gene |
| SGQ77_RS10110 (SGQ77_10110) | - | 2045001..2045618 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| SGQ77_RS10115 (SGQ77_10115) | - | 2045699..2046619 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SGQ77_RS10120 (SGQ77_10120) | - | 2046621..2048564 (-) | 1944 | WP_000700560.1 | AAA family ATPase | - |
| SGQ77_RS10125 (SGQ77_10125) | - | 2048573..2048836 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SGQ77_RS10130 (SGQ77_10130) | - | 2048845..2049105 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| SGQ77_RS10135 (SGQ77_10135) | - | 2049198..2049359 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SGQ77_RS10140 (SGQ77_10140) | - | 2049356..2049676 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SGQ77_RS10145 (SGQ77_10145) | - | 2049735..2050367 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SGQ77_RS10150 (SGQ77_10150) | - | 2050382..2050522 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SGQ77_RS10155 (SGQ77_10155) | - | 2050553..2050750 (-) | 198 | Protein_1962 | hypothetical protein | - |
| SGQ77_RS10160 (SGQ77_10160) | - | 2050766..2051518 (-) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| SGQ77_RS10165 (SGQ77_10165) | - | 2051575..2052114 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SGQ77_RS10170 (SGQ77_10170) | - | 2052138..2052398 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SGQ77_RS10175 (SGQ77_10175) | - | 2052416..2052640 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| SGQ77_RS10180 (SGQ77_10180) | - | 2052799..2053569 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| SGQ77_RS10185 (SGQ77_10185) | - | 2053769..2053951 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| SGQ77_RS10190 (SGQ77_10190) | - | 2053987..2054133 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SGQ77_RS10195 (SGQ77_10195) | - | 2054130..2054744 (-) | 615 | WP_000191460.1 | hypothetical protein | - |
| SGQ77_RS10200 (SGQ77_10200) | - | 2054852..2055889 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SGQ77_RS10205 (SGQ77_10205) | sph | 2055940..2056770 (+) | 831 | Protein_1972 | sphingomyelin phosphodiesterase | - |
| SGQ77_RS10210 (SGQ77_10210) | lukG | 2057008..2058024 (-) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| SGQ77_RS10215 (SGQ77_10215) | lukH | 2058046..2059098 (-) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| SGQ77_RS10220 (SGQ77_10220) | - | 2059533..2060756 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| SGQ77_RS10225 (SGQ77_10225) | - | 2061128..2061973 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| SGQ77_RS10230 (SGQ77_10230) | - | 2062035..2062946 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| SGQ77_RS10235 (SGQ77_10235) | - | 2063107..2064414 (+) | 1308 | WP_001045063.1 | TrkH family potassium uptake protein | - |
| SGQ77_RS10240 (SGQ77_10240) | - | 2065257..2065700 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| SGQ77_RS10245 (SGQ77_10245) | - | 2065806..2066243 (-) | 438 | WP_072419900.1 | hypothetical protein | - |
| SGQ77_RS10250 (SGQ77_10250) | - | 2066560..2067150 (-) | 591 | WP_001293059.1 | terminase small subunit | - |
| SGQ77_RS10255 (SGQ77_10255) | - | 2067147..2067359 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| SGQ77_RS10260 (SGQ77_10260) | - | 2067420..2067966 (+) | 547 | Protein_1983 | site-specific integrase | - |
| SGQ77_RS10265 (SGQ77_10265) | groL | 2068061..2069677 (-) | 1617 | WP_000240649.1 | chaperonin GroEL | - |
| SGQ77_RS10270 (SGQ77_10270) | groES | 2069753..2070037 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| SGQ77_RS10275 (SGQ77_10275) | mroQ | 2070214..2070957 (+) | 744 | WP_000197645.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| SGQ77_RS10280 (SGQ77_10280) | - | 2070982..2072241 (-) | 1260 | WP_000120317.1 | SdrH family protein | - |
| SGQ77_RS10285 (SGQ77_10285) | - | 2072438..2073064 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17658.50 Da Isoelectric Point: 4.9628
>NTDB_id=905690 SGQ77_RS10105 WP_000610650.1 2044530..2045000(-) (ssbA) [Staphylococcus aureus strain 1061]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=905690 SGQ77_RS10105 WP_000610650.1 2044530..2045000(-) (ssbA) [Staphylococcus aureus strain 1061]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |