Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SGQ72_RS10015 | Genome accession | NZ_CP138881 |
| Coordinates | 2029631..2030101 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610650.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 263 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2001147..2055137 | 2029631..2030101 | within | 0 |
Gene organization within MGE regions
Location: 2001147..2055137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGQ72_RS09820 (SGQ72_09815) | scn | 2001147..2001497 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SGQ72_RS09825 (SGQ72_09820) | - | 2002180..2002629 (+) | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| SGQ72_RS09830 (SGQ72_09825) | - | 2002722..2003056 (-) | 335 | Protein_1897 | SH3 domain-containing protein | - |
| SGQ72_RS09835 (SGQ72_09830) | sak | 2003707..2004198 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| SGQ72_RS09840 (SGQ72_09835) | - | 2004389..2005144 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SGQ72_RS09845 (SGQ72_09840) | - | 2005156..2005410 (-) | 255 | WP_000611512.1 | phage holin | - |
| SGQ72_RS09850 (SGQ72_09845) | - | 2005462..2005569 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SGQ72_RS09855 (SGQ72_09850) | pepG1 | 2005622..2005756 (-) | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SGQ72_RS09860 (SGQ72_09855) | - | 2005950..2006246 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SGQ72_RS09865 (SGQ72_09860) | - | 2006304..2006591 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SGQ72_RS09870 (SGQ72_09865) | - | 2006638..2006790 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| SGQ72_RS09875 (SGQ72_09870) | - | 2006780..2010565 (-) | 3786 | WP_234111210.1 | phage tail spike protein | - |
| SGQ72_RS09880 (SGQ72_09875) | - | 2010581..2012065 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| SGQ72_RS09885 (SGQ72_09880) | - | 2012062..2016591 (-) | 4530 | WP_001805631.1 | phage tail tape measure protein | - |
| SGQ72_RS09890 (SGQ72_09885) | - | 2016648..2016782 (-) | 135 | WP_000364140.1 | hypothetical protein | - |
| SGQ72_RS09895 (SGQ72_09890) | - | 2016836..2017186 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SGQ72_RS09900 (SGQ72_09895) | - | 2017236..2017466 (-) | 231 | Protein_1911 | Ig-like domain-containing protein | - |
| SGQ72_RS09905 (SGQ72_09900) | - | 2017502..2018146 (-) | 645 | WP_000268739.1 | major tail protein | - |
| SGQ72_RS09910 (SGQ72_09905) | - | 2018147..2018554 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SGQ72_RS09915 (SGQ72_09910) | - | 2018551..2018955 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SGQ72_RS09920 (SGQ72_09915) | - | 2018952..2019314 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SGQ72_RS09925 (SGQ72_09920) | - | 2019298..2019582 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SGQ72_RS09930 (SGQ72_09925) | - | 2019572..2019856 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SGQ72_RS09935 (SGQ72_09930) | - | 2019876..2021021 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SGQ72_RS09940 (SGQ72_09935) | - | 2021045..2021782 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| SGQ72_RS09945 (SGQ72_09940) | - | 2021766..2022953 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SGQ72_RS09950 (SGQ72_09945) | - | 2022969..2024630 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SGQ72_RS09955 (SGQ72_09950) | - | 2024627..2024971 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SGQ72_RS09960 (SGQ72_09955) | - | 2025100..2025399 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SGQ72_RS09965 (SGQ72_09960) | - | 2025631..2026047 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SGQ72_RS09970 (SGQ72_09965) | - | 2026075..2026275 (-) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| SGQ72_RS09975 (SGQ72_09970) | - | 2026395..2026649 (-) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| SGQ72_RS09980 (SGQ72_09975) | - | 2026642..2026926 (-) | 285 | WP_001105620.1 | hypothetical protein | - |
| SGQ72_RS09985 (SGQ72_09980) | - | 2026923..2027372 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| SGQ72_RS09990 (SGQ72_09985) | - | 2027437..2027685 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| SGQ72_RS09995 (SGQ72_09990) | - | 2027686..2028057 (-) | 372 | WP_000101268.1 | SA1788 family PVL leukocidin-associated protein | - |
| SGQ72_RS10000 (SGQ72_09995) | - | 2028070..2028474 (-) | 405 | WP_000401976.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGQ72_RS10005 (SGQ72_10000) | - | 2028483..2028701 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SGQ72_RS10010 (SGQ72_10005) | - | 2028708..2029601 (-) | 894 | WP_000148326.1 | DnaD domain-containing protein | - |
| SGQ72_RS10015 (SGQ72_10010) | ssbA | 2029631..2030101 (-) | 471 | WP_000610650.1 | single-stranded DNA-binding protein | Machinery gene |
| SGQ72_RS10020 (SGQ72_10015) | - | 2030102..2030719 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| SGQ72_RS10025 (SGQ72_10020) | - | 2030800..2031720 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SGQ72_RS10030 (SGQ72_10025) | - | 2031722..2033665 (-) | 1944 | WP_000700560.1 | AAA family ATPase | - |
| SGQ72_RS10035 (SGQ72_10030) | - | 2033674..2033937 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SGQ72_RS10040 (SGQ72_10035) | - | 2033946..2034206 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| SGQ72_RS10045 (SGQ72_10040) | - | 2034299..2034460 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SGQ72_RS10050 (SGQ72_10045) | - | 2034457..2034777 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SGQ72_RS10055 (SGQ72_10050) | - | 2034836..2035468 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SGQ72_RS10060 (SGQ72_10055) | - | 2035483..2035623 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SGQ72_RS10065 (SGQ72_10060) | - | 2035654..2035851 (-) | 198 | Protein_1944 | hypothetical protein | - |
| SGQ72_RS10070 (SGQ72_10065) | - | 2035867..2036619 (-) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| SGQ72_RS10075 (SGQ72_10070) | - | 2036676..2037215 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SGQ72_RS10080 (SGQ72_10075) | - | 2037239..2037499 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SGQ72_RS10085 (SGQ72_10080) | - | 2037517..2037741 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| SGQ72_RS10090 (SGQ72_10085) | - | 2037900..2038670 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| SGQ72_RS10095 (SGQ72_10090) | - | 2038870..2039052 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| SGQ72_RS10100 (SGQ72_10095) | - | 2039088..2039234 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SGQ72_RS10105 (SGQ72_10100) | - | 2039231..2039845 (-) | 615 | WP_000191460.1 | hypothetical protein | - |
| SGQ72_RS10110 (SGQ72_10105) | - | 2039953..2040990 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SGQ72_RS10115 (SGQ72_10110) | sph | 2041041..2041871 (+) | 831 | Protein_1954 | sphingomyelin phosphodiesterase | - |
| SGQ72_RS10120 (SGQ72_10115) | lukG | 2042109..2043125 (-) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| SGQ72_RS10125 (SGQ72_10120) | lukH | 2043147..2044199 (-) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| SGQ72_RS10130 (SGQ72_10125) | - | 2044634..2045857 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| SGQ72_RS10135 (SGQ72_10130) | - | 2046229..2047074 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| SGQ72_RS10140 (SGQ72_10135) | - | 2047136..2048047 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| SGQ72_RS10145 (SGQ72_10140) | - | 2048208..2049515 (+) | 1308 | WP_001045063.1 | TrkH family potassium uptake protein | - |
| SGQ72_RS10150 (SGQ72_10145) | - | 2050358..2050801 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| SGQ72_RS10155 (SGQ72_10150) | - | 2050907..2051343 (-) | 437 | Protein_1962 | hypothetical protein | - |
| SGQ72_RS10160 (SGQ72_10155) | - | 2051660..2052250 (-) | 591 | WP_001293059.1 | terminase small subunit | - |
| SGQ72_RS10165 (SGQ72_10160) | - | 2052247..2052459 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| SGQ72_RS10170 (SGQ72_10165) | - | 2052520..2053066 (+) | 547 | Protein_1965 | site-specific integrase | - |
| SGQ72_RS10175 (SGQ72_10170) | groL | 2053161..2054777 (-) | 1617 | WP_000240649.1 | chaperonin GroEL | - |
| SGQ72_RS10180 (SGQ72_10175) | groES | 2054853..2055137 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17658.50 Da Isoelectric Point: 4.9628
>NTDB_id=905610 SGQ72_RS10015 WP_000610650.1 2029631..2030101(-) (ssbA) [Staphylococcus aureus strain 263]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=905610 SGQ72_RS10015 WP_000610650.1 2029631..2030101(-) (ssbA) [Staphylococcus aureus strain 263]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |