Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SGQ73_RS10090 | Genome accession | NZ_CP138878 |
| Coordinates | 2042719..2043189 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610650.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 96 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2014235..2068226 | 2042719..2043189 | within | 0 |
Gene organization within MGE regions
Location: 2014235..2068226
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGQ73_RS09895 (SGQ73_09895) | scn | 2014235..2014585 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SGQ73_RS09900 (SGQ73_09900) | - | 2015268..2015717 (+) | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| SGQ73_RS09905 (SGQ73_09905) | - | 2015810..2016144 (-) | 335 | Protein_1912 | SH3 domain-containing protein | - |
| SGQ73_RS09910 (SGQ73_09910) | sak | 2016795..2017286 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| SGQ73_RS09915 (SGQ73_09915) | - | 2017477..2018232 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SGQ73_RS09920 (SGQ73_09920) | - | 2018244..2018498 (-) | 255 | WP_000611512.1 | phage holin | - |
| SGQ73_RS09925 (SGQ73_09925) | - | 2018550..2018657 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SGQ73_RS09930 (SGQ73_09930) | pepG1 | 2018710..2018844 (-) | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SGQ73_RS09935 (SGQ73_09935) | - | 2019038..2019334 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SGQ73_RS09940 (SGQ73_09940) | - | 2019392..2019679 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SGQ73_RS09945 (SGQ73_09945) | - | 2019726..2019878 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| SGQ73_RS09950 (SGQ73_09950) | - | 2019868..2023653 (-) | 3786 | WP_303061654.1 | phage tail spike protein | - |
| SGQ73_RS09955 (SGQ73_09955) | - | 2023669..2025153 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| SGQ73_RS09960 (SGQ73_09960) | - | 2025150..2029679 (-) | 4530 | WP_001805631.1 | phage tail tape measure protein | - |
| SGQ73_RS09965 (SGQ73_09965) | - | 2029736..2029873 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| SGQ73_RS09970 (SGQ73_09970) | - | 2029924..2030274 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SGQ73_RS09975 (SGQ73_09975) | - | 2030324..2030554 (-) | 231 | Protein_1926 | Ig-like domain-containing protein | - |
| SGQ73_RS09980 (SGQ73_09980) | - | 2030590..2031234 (-) | 645 | WP_000268739.1 | major tail protein | - |
| SGQ73_RS09985 (SGQ73_09985) | - | 2031235..2031642 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SGQ73_RS09990 (SGQ73_09990) | - | 2031639..2032043 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SGQ73_RS09995 (SGQ73_09995) | - | 2032040..2032402 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SGQ73_RS10000 (SGQ73_10000) | - | 2032386..2032670 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SGQ73_RS10005 (SGQ73_10005) | - | 2032660..2032943 (-) | 284 | Protein_1932 | hypothetical protein | - |
| SGQ73_RS10010 (SGQ73_10010) | - | 2032963..2034108 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SGQ73_RS10015 (SGQ73_10015) | - | 2034132..2034869 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| SGQ73_RS10020 (SGQ73_10020) | - | 2034853..2036040 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SGQ73_RS10025 (SGQ73_10025) | - | 2036056..2037717 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SGQ73_RS10030 (SGQ73_10030) | - | 2037714..2038058 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SGQ73_RS10035 (SGQ73_10035) | - | 2038188..2038487 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SGQ73_RS10040 (SGQ73_10040) | - | 2038719..2039135 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SGQ73_RS10045 (SGQ73_10045) | - | 2039163..2039363 (-) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| SGQ73_RS10050 (SGQ73_10050) | - | 2039483..2039737 (-) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| SGQ73_RS10055 (SGQ73_10055) | - | 2039730..2040014 (-) | 285 | WP_001105620.1 | hypothetical protein | - |
| SGQ73_RS10060 (SGQ73_10060) | - | 2040011..2040460 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| SGQ73_RS10065 (SGQ73_10065) | - | 2040525..2040773 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| SGQ73_RS10070 (SGQ73_10070) | - | 2040774..2041145 (-) | 372 | WP_000101268.1 | SA1788 family PVL leukocidin-associated protein | - |
| SGQ73_RS10075 (SGQ73_10075) | - | 2041158..2041562 (-) | 405 | WP_000401976.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGQ73_RS10080 (SGQ73_10080) | - | 2041571..2041789 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SGQ73_RS10085 (SGQ73_10085) | - | 2041796..2042689 (-) | 894 | WP_000148326.1 | DnaD domain-containing protein | - |
| SGQ73_RS10090 (SGQ73_10090) | ssbA | 2042719..2043189 (-) | 471 | WP_000610650.1 | single-stranded DNA-binding protein | Machinery gene |
| SGQ73_RS10095 (SGQ73_10095) | - | 2043190..2043807 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| SGQ73_RS10100 (SGQ73_10100) | - | 2043888..2044808 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SGQ73_RS10105 (SGQ73_10105) | - | 2044810..2046753 (-) | 1944 | WP_000700560.1 | AAA family ATPase | - |
| SGQ73_RS10110 (SGQ73_10110) | - | 2046762..2047025 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SGQ73_RS10115 (SGQ73_10115) | - | 2047034..2047294 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| SGQ73_RS10120 (SGQ73_10120) | - | 2047387..2047548 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SGQ73_RS10125 (SGQ73_10125) | - | 2047545..2047865 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SGQ73_RS10130 (SGQ73_10130) | - | 2047924..2048556 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SGQ73_RS10135 (SGQ73_10135) | - | 2048571..2048711 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SGQ73_RS10140 (SGQ73_10140) | - | 2048742..2048939 (-) | 198 | Protein_1959 | hypothetical protein | - |
| SGQ73_RS10145 (SGQ73_10145) | - | 2048955..2049707 (-) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| SGQ73_RS10150 (SGQ73_10150) | - | 2049764..2050303 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SGQ73_RS10155 (SGQ73_10155) | - | 2050327..2050587 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SGQ73_RS10160 (SGQ73_10160) | - | 2050605..2050829 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| SGQ73_RS10165 (SGQ73_10165) | - | 2050988..2051758 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| SGQ73_RS10170 (SGQ73_10170) | - | 2051958..2052140 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| SGQ73_RS10175 (SGQ73_10175) | - | 2052176..2052322 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SGQ73_RS10180 (SGQ73_10180) | - | 2052319..2052933 (-) | 615 | WP_000191460.1 | hypothetical protein | - |
| SGQ73_RS10185 (SGQ73_10185) | - | 2053041..2054078 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SGQ73_RS10190 (SGQ73_10190) | sph | 2054129..2054959 (+) | 831 | Protein_1969 | sphingomyelin phosphodiesterase | - |
| SGQ73_RS10195 (SGQ73_10195) | lukG | 2055197..2056213 (-) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| SGQ73_RS10200 (SGQ73_10200) | lukH | 2056235..2057287 (-) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| SGQ73_RS10205 (SGQ73_10205) | - | 2057722..2058945 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| SGQ73_RS10210 (SGQ73_10210) | - | 2059317..2060162 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| SGQ73_RS10215 (SGQ73_10215) | - | 2060224..2061135 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| SGQ73_RS10220 (SGQ73_10220) | - | 2061296..2062603 (+) | 1308 | WP_001045063.1 | TrkH family potassium uptake protein | - |
| SGQ73_RS10225 (SGQ73_10225) | - | 2063446..2063889 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| SGQ73_RS10230 (SGQ73_10230) | - | 2063995..2064432 (-) | 438 | WP_072419900.1 | hypothetical protein | - |
| SGQ73_RS10235 (SGQ73_10235) | - | 2064749..2065339 (-) | 591 | WP_001293059.1 | terminase small subunit | - |
| SGQ73_RS10240 (SGQ73_10240) | - | 2065336..2065548 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| SGQ73_RS10245 (SGQ73_10245) | - | 2065609..2066155 (+) | 547 | Protein_1980 | site-specific integrase | - |
| SGQ73_RS10250 (SGQ73_10250) | groL | 2066250..2067866 (-) | 1617 | WP_000240649.1 | chaperonin GroEL | - |
| SGQ73_RS10255 (SGQ73_10255) | groES | 2067942..2068226 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17658.50 Da Isoelectric Point: 4.9628
>NTDB_id=905528 SGQ73_RS10090 WP_000610650.1 2042719..2043189(-) (ssbA) [Staphylococcus aureus strain 96]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=905528 SGQ73_RS10090 WP_000610650.1 2042719..2043189(-) (ssbA) [Staphylococcus aureus strain 96]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |