Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SGQ78_RS10075 | Genome accession | NZ_CP138859 |
| Coordinates | 2039870..2040340 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610650.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 15 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2011385..2057313 | 2039870..2040340 | within | 0 |
Gene organization within MGE regions
Location: 2011385..2057313
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGQ78_RS09880 (SGQ78_09880) | scn | 2011385..2011735 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SGQ78_RS09885 (SGQ78_09885) | - | 2012418..2012867 (+) | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| SGQ78_RS09890 (SGQ78_09890) | - | 2012960..2013294 (-) | 335 | Protein_1909 | SH3 domain-containing protein | - |
| SGQ78_RS09895 (SGQ78_09895) | sak | 2013945..2014436 (-) | 492 | WP_047432378.1 | staphylokinase | - |
| SGQ78_RS09900 (SGQ78_09900) | - | 2014627..2015382 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SGQ78_RS09905 (SGQ78_09905) | - | 2015394..2015648 (-) | 255 | WP_000611512.1 | phage holin | - |
| SGQ78_RS09910 (SGQ78_09910) | - | 2015700..2015807 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SGQ78_RS09915 (SGQ78_09915) | pepG1 | 2015860..2015994 (-) | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SGQ78_RS09920 (SGQ78_09920) | - | 2016188..2016484 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SGQ78_RS09925 (SGQ78_09925) | - | 2016542..2016829 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SGQ78_RS09930 (SGQ78_09930) | - | 2016876..2017028 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| SGQ78_RS09935 (SGQ78_09935) | - | 2017018..2020803 (-) | 3786 | WP_353058581.1 | phage tail spike protein | - |
| SGQ78_RS09940 (SGQ78_09940) | - | 2020819..2022303 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| SGQ78_RS09945 (SGQ78_09945) | - | 2022300..2026829 (-) | 4530 | WP_001805631.1 | phage tail tape measure protein | - |
| SGQ78_RS09950 (SGQ78_09950) | - | 2026886..2027047 (-) | 162 | WP_001789580.1 | hypothetical protein | - |
| SGQ78_RS09955 (SGQ78_09955) | - | 2027074..2027424 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SGQ78_RS09960 (SGQ78_09960) | - | 2027474..2027704 (-) | 231 | Protein_1923 | Ig-like domain-containing protein | - |
| SGQ78_RS09965 (SGQ78_09965) | - | 2027740..2028384 (-) | 645 | WP_000268739.1 | major tail protein | - |
| SGQ78_RS09970 (SGQ78_09970) | - | 2028385..2028792 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SGQ78_RS09975 (SGQ78_09975) | - | 2028789..2029193 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SGQ78_RS09980 (SGQ78_09980) | - | 2029190..2029552 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SGQ78_RS09985 (SGQ78_09985) | - | 2029536..2029820 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SGQ78_RS09990 (SGQ78_09990) | - | 2029810..2030094 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SGQ78_RS09995 (SGQ78_09995) | - | 2030114..2031259 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SGQ78_RS10000 (SGQ78_10000) | - | 2031283..2032020 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| SGQ78_RS10005 (SGQ78_10005) | - | 2032004..2033191 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SGQ78_RS10010 (SGQ78_10010) | - | 2033207..2034868 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SGQ78_RS10015 (SGQ78_10015) | - | 2034865..2035209 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SGQ78_RS10020 (SGQ78_10020) | - | 2035339..2035638 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SGQ78_RS10025 (SGQ78_10025) | - | 2035870..2036286 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SGQ78_RS10030 (SGQ78_10030) | - | 2036314..2036514 (-) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| SGQ78_RS10035 (SGQ78_10035) | - | 2036634..2036888 (-) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| SGQ78_RS10040 (SGQ78_10040) | - | 2036881..2037165 (-) | 285 | WP_001105620.1 | hypothetical protein | - |
| SGQ78_RS10045 (SGQ78_10045) | - | 2037162..2037611 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| SGQ78_RS10050 (SGQ78_10050) | - | 2037676..2037924 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| SGQ78_RS10055 (SGQ78_10055) | - | 2037925..2038296 (-) | 372 | WP_000101268.1 | SA1788 family PVL leukocidin-associated protein | - |
| SGQ78_RS10060 (SGQ78_10060) | - | 2038309..2038713 (-) | 405 | WP_000401976.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGQ78_RS10065 (SGQ78_10065) | - | 2038722..2038940 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SGQ78_RS10070 (SGQ78_10070) | - | 2038947..2039840 (-) | 894 | WP_000148326.1 | DnaD domain-containing protein | - |
| SGQ78_RS10075 (SGQ78_10075) | ssbA | 2039870..2040340 (-) | 471 | WP_000610650.1 | single-stranded DNA-binding protein | Machinery gene |
| SGQ78_RS10080 (SGQ78_10080) | - | 2040341..2040958 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| SGQ78_RS10085 (SGQ78_10085) | - | 2041039..2041959 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SGQ78_RS10090 (SGQ78_10090) | - | 2041961..2043904 (-) | 1944 | WP_000700560.1 | AAA family ATPase | - |
| SGQ78_RS10095 (SGQ78_10095) | - | 2043913..2044176 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SGQ78_RS10100 (SGQ78_10100) | - | 2044185..2044445 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| SGQ78_RS10105 (SGQ78_10105) | - | 2044538..2044699 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SGQ78_RS10110 (SGQ78_10110) | - | 2044696..2045016 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SGQ78_RS10115 (SGQ78_10115) | - | 2045075..2045707 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SGQ78_RS10120 (SGQ78_10120) | - | 2045722..2045862 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SGQ78_RS10125 (SGQ78_10125) | - | 2045893..2046090 (-) | 198 | Protein_1956 | hypothetical protein | - |
| SGQ78_RS10130 (SGQ78_10130) | - | 2046106..2046858 (-) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| SGQ78_RS10135 (SGQ78_10135) | - | 2046915..2047454 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SGQ78_RS10140 (SGQ78_10140) | - | 2047478..2047738 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SGQ78_RS10145 (SGQ78_10145) | - | 2047756..2047980 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| SGQ78_RS10150 (SGQ78_10150) | - | 2048139..2048909 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| SGQ78_RS10155 (SGQ78_10155) | - | 2049109..2049291 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| SGQ78_RS10160 (SGQ78_10160) | - | 2049327..2049473 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SGQ78_RS10165 (SGQ78_10165) | - | 2049470..2050084 (-) | 615 | WP_000191460.1 | hypothetical protein | - |
| SGQ78_RS10170 (SGQ78_10170) | - | 2050192..2051229 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SGQ78_RS10175 (SGQ78_10175) | sph | 2051280..2052110 (+) | 831 | Protein_1966 | sphingomyelin phosphodiesterase | - |
| SGQ78_RS10180 (SGQ78_10180) | lukG | 2052348..2053364 (-) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| SGQ78_RS10185 (SGQ78_10185) | lukH | 2053386..2054438 (-) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| SGQ78_RS10190 (SGQ78_10190) | - | 2054873..2056096 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| SGQ78_RS10195 (SGQ78_10195) | - | 2056468..2057313 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17658.50 Da Isoelectric Point: 4.9628
>NTDB_id=905240 SGQ78_RS10075 WP_000610650.1 2039870..2040340(-) (ssbA) [Staphylococcus aureus strain 15]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=905240 SGQ78_RS10075 WP_000610650.1 2039870..2040340(-) (ssbA) [Staphylococcus aureus strain 15]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |