Detailed information
Overview
| Name | comYD | Type | Machinery gene |
| Locus tag | SE861_RS01095 | Genome accession | NZ_CP138371 |
| Coordinates | 189010..189438 (+) | Length | 142 a.a. |
| NCBI ID | WP_000793381.1 | Uniprot ID | A0A8B4RCN7 |
| Organism | Streptococcus agalactiae strain R31-snf2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 190299..235979 | 189010..189438 | flank | 861 |
Gene organization within MGE regions
Location: 189010..235979
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE861_RS01095 (SE861_01095) | comYD | 189010..189438 (+) | 429 | WP_000793381.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SE861_RS01100 (SE861_01100) | comGE | 189410..189709 (+) | 300 | WP_001867089.1 | competence type IV pilus minor pilin ComGE | - |
| SE861_RS01105 (SE861_01105) | comGF | 189663..190124 (+) | 462 | WP_001874060.1 | competence type IV pilus minor pilin ComGF | - |
| SE861_RS01110 (SE861_01110) | comGG | 190102..190473 (+) | 372 | WP_000601104.1 | competence type IV pilus minor pilin ComGG | - |
| SE861_RS01115 (SE861_01115) | comYH | 190588..191562 (+) | 975 | WP_001008570.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SE861_RS01120 (SE861_01120) | - | 191594..192787 (+) | 1194 | WP_000047535.1 | acetate kinase | - |
| SE861_RS01125 (SE861_01125) | - | 192938..193144 (+) | 207 | WP_000798242.1 | helix-turn-helix transcriptional regulator | - |
| SE861_RS01130 (SE861_01130) | - | 193203..193340 (+) | 138 | WP_001867090.1 | hypothetical protein | - |
| SE861_RS01135 (SE861_01135) | - | 193381..193836 (+) | 456 | WP_000905674.1 | hypothetical protein | - |
| SE861_RS01140 (SE861_01140) | - | 193905..194570 (+) | 666 | WP_000008111.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SE861_RS01145 (SE861_01145) | proC | 194591..195361 (-) | 771 | WP_001867096.1 | pyrroline-5-carboxylate reductase | - |
| SE861_RS01150 (SE861_01150) | pepA | 195431..196498 (-) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| SE861_RS01155 (SE861_01155) | - | 196683..196922 (-) | 240 | WP_000660181.1 | hypothetical protein | - |
| SE861_RS01160 (SE861_01160) | - | 197083..197367 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| SE861_RS01165 (SE861_01165) | - | 197364..197687 (+) | 324 | WP_000601792.1 | thioredoxin family protein | - |
| SE861_RS01170 (SE861_01170) | ytpR | 197720..198346 (+) | 627 | WP_000578331.1 | YtpR family tRNA-binding protein | - |
| SE861_RS01175 (SE861_01175) | - | 198400..199116 (-) | 717 | WP_000186183.1 | class I SAM-dependent methyltransferase | - |
| SE861_RS01180 (SE861_01180) | ssbA | 199197..199592 (+) | 396 | WP_000282450.1 | single-stranded DNA-binding protein | Machinery gene |
| SE861_RS01185 (SE861_01185) | - | 199715..200359 (+) | 645 | WP_000416612.1 | HAD family phosphatase | - |
| SE861_RS01190 (SE861_01190) | - | 200386..202131 (+) | 1746 | WP_047198532.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| SE861_RS01195 (SE861_01195) | - | 202112..202852 (+) | 741 | WP_000697630.1 | LytTR family DNA-binding domain-containing protein | - |
| SE861_RS01200 (SE861_01200) | - | 203022..203477 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| SE861_RS01205 (SE861_01205) | lrgB | 203479..204207 (+) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| SE861_RS01210 (SE861_01210) | - | 204450..206078 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| SE861_RS01215 (SE861_01215) | - | 206191..207168 (+) | 978 | WP_000680644.1 | ABC transporter permease | - |
| SE861_RS01220 (SE861_01220) | - | 207165..207986 (+) | 822 | WP_319099080.1 | ABC transporter permease | - |
| SE861_RS01225 (SE861_01225) | - | 207998..208801 (+) | 804 | WP_000140979.1 | ABC transporter ATP-binding protein | - |
| SE861_RS01230 (SE861_01230) | - | 208785..209411 (+) | 627 | WP_000171304.1 | ABC transporter ATP-binding protein | - |
| SE861_RS01235 (SE861_01235) | treP | 209693..211723 (+) | 2031 | WP_000434610.1 | PTS system trehalose-specific EIIBC component | - |
| SE861_RS01240 (SE861_01240) | treC | 211945..213570 (+) | 1626 | WP_000151014.1 | alpha,alpha-phosphotrehalase | - |
| SE861_RS01245 (SE861_01245) | - | 213790..215826 (+) | 2037 | WP_000228178.1 | BglG family transcription antiterminator | - |
| SE861_RS01250 (SE861_01250) | - | 215829..216113 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| SE861_RS01255 (SE861_01255) | - | 216126..217481 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| SE861_RS01260 (SE861_01260) | - | 217484..218341 (+) | 858 | WP_000203492.1 | transketolase | - |
| SE861_RS01265 (SE861_01265) | - | 218338..219267 (+) | 930 | WP_001203828.1 | transketolase family protein | - |
| SE861_RS01270 (SE861_01270) | - | 219376..220635 (+) | 1260 | WP_001203074.1 | ferric reductase-like transmembrane domain-containing protein | - |
| SE861_RS01275 (SE861_01275) | rpsO | 220723..220992 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| SE861_RS01280 (SE861_01280) | pnp | 221373..223502 (+) | 2130 | WP_000043857.1 | polyribonucleotide nucleotidyltransferase | - |
| SE861_RS01285 (SE861_01285) | - | 223504..224256 (+) | 753 | WP_000204780.1 | SseB family protein | - |
| SE861_RS01290 (SE861_01290) | cysE | 224265..224849 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| SE861_RS01295 (SE861_01295) | - | 224859..225041 (+) | 183 | WP_000656477.1 | hypothetical protein | - |
| SE861_RS01300 (SE861_01300) | cysS | 225038..226381 (+) | 1344 | WP_000591129.1 | cysteine--tRNA ligase | - |
| SE861_RS01305 (SE861_01305) | - | 226374..226760 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| SE861_RS01310 (SE861_01310) | rlmB | 226863..227618 (+) | 756 | WP_000178023.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| SE861_RS01315 (SE861_01315) | - | 227615..228133 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| SE861_RS01320 (SE861_01320) | - | 228226..229086 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| SE861_RS01325 (SE861_01325) | - | 229624..229743 (+) | 120 | Protein_208 | helix-turn-helix transcriptional regulator | - |
| SE861_RS01330 (SE861_01330) | - | 230061..231227 (-) | 1167 | WP_000160598.1 | IS30-like element ISSag9 family transposase | - |
| SE861_RS01335 (SE861_01335) | rplM | 231528..231974 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| SE861_RS01340 (SE861_01340) | rpsI | 231995..232387 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| SE861_RS01345 (SE861_01345) | - | 232533..233687 (-) | 1155 | WP_000110711.1 | site-specific integrase | - |
| SE861_RS01350 (SE861_01350) | - | 233742..234260 (-) | 519 | WP_000181342.1 | helix-turn-helix domain-containing protein | - |
| SE861_RS01355 (SE861_01355) | - | 234407..234691 (+) | 285 | WP_001287945.1 | hypothetical protein | - |
| SE861_RS01360 (SE861_01360) | - | 234703..235557 (+) | 855 | WP_000005759.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SE861_RS01365 (SE861_01365) | - | 235568..235858 (+) | 291 | WP_000158581.1 | DUF5962 family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16493.15 Da Isoelectric Point: 10.0345
>NTDB_id=902435 SE861_RS01095 WP_000793381.1 189010..189438(+) (comYD) [Streptococcus agalactiae strain R31-snf2]
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
Nucleotide
Download Length: 429 bp
>NTDB_id=902435 SE861_RS01095 WP_000793381.1 189010..189438(+) (comYD) [Streptococcus agalactiae strain R31-snf2]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYD | Streptococcus mutans UA140 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus mutans UA159 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
43.662 |
100 |
0.437 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
41.045 |
94.366 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus mitis SK321 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae D39 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae R6 |
42.52 |
89.437 |
0.38 |