Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   R2H34_RS04095 Genome accession   NZ_CP137746
Coordinates   839225..839578 (+) Length   117 a.a.
NCBI ID   WP_053469834.1    Uniprot ID   -
Organism   Acinetobacter sp. 16     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 807435..852955 839225..839578 within 0


Gene organization within MGE regions


Location: 807435..852955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R2H34_RS03875 - 807435..808499 (-) 1065 WP_318342426.1 phage portal protein -
  R2H34_RS03880 - 808499..810277 (-) 1779 WP_318342427.1 terminase large subunit domain-containing protein -
  R2H34_RS03885 - 810456..811286 (+) 831 WP_318342428.1 GPO family capsid scaffolding protein -
  R2H34_RS03890 - 811333..812343 (+) 1011 WP_289344679.1 phage major capsid protein, P2 family -
  R2H34_RS03895 gpM 812350..813204 (+) 855 WP_318342429.1 phage terminase small subunit -
  R2H34_RS03900 - 813303..813752 (+) 450 WP_151724455.1 head completion/stabilization protein -
  R2H34_RS03905 - 813755..813982 (+) 228 WP_318342430.1 hypothetical protein -
  R2H34_RS03910 - 813986..814198 (+) 213 WP_318342431.1 tail protein X -
  R2H34_RS03915 - 814216..814572 (+) 357 WP_318342432.1 putative holin -
  R2H34_RS03920 - 814569..814841 (+) 273 WP_318342433.1 phage holin family protein -
  R2H34_RS03925 - 814838..815692 (+) 855 WP_318342434.1 N-acetylmuramidase family protein -
  R2H34_RS03930 - 815689..816189 (+) 501 WP_318342435.1 phage tail protein -
  R2H34_RS03935 - 816189..816641 (+) 453 WP_318342436.1 phage virion morphogenesis protein -
  R2H34_RS03940 - 816714..817361 (+) 648 WP_318342437.1 phage baseplate assembly protein V -
  R2H34_RS03945 - 817358..817702 (+) 345 WP_318342438.1 GPW/gp25 family protein -
  R2H34_RS03950 - 817699..818589 (+) 891 WP_318342439.1 baseplate J/gp47 family protein -
  R2H34_RS03955 - 818589..819200 (+) 612 WP_318342440.1 phage tail protein I -
  R2H34_RS03960 - 819203..821851 (+) 2649 WP_318342441.1 phage tail protein -
  R2H34_RS03965 - 821956..823128 (+) 1173 WP_318342442.1 phage tail sheath protein -
  R2H34_RS03970 - 823139..823654 (+) 516 WP_318342443.1 phage major tail tube protein -
  R2H34_RS03975 - 823720..824055 (+) 336 WP_208476806.1 phage tail assembly protein -
  R2H34_RS03980 - 824115..824183 (+) 69 WP_243897849.1 hypothetical protein -
  R2H34_RS03985 - 824180..826825 (+) 2646 WP_318342444.1 phage tail tape measure protein -
  R2H34_RS03990 - 826831..827253 (+) 423 WP_077165972.1 phage tail protein -
  R2H34_RS03995 - 827250..828746 (+) 1497 WP_318342445.1 contractile injection system protein, VgrG/Pvc8 family -
  R2H34_RS04000 - 828792..829595 (-) 804 WP_318342446.1 DNA adenine methylase -
  R2H34_RS04005 - 829561..829761 (-) 201 WP_318342447.1 Com family DNA-binding transcriptional regulator -
  R2H34_RS04010 - 829875..830168 (+) 294 WP_318342448.1 ogr/Delta-like zinc finger family protein -
  R2H34_RS04015 - 830165..830593 (+) 429 WP_318342449.1 hypothetical protein -
  R2H34_RS04020 - 830590..830814 (+) 225 WP_318342450.1 hypothetical protein -
  R2H34_RS04025 - 830841..831302 (-) 462 WP_318342451.1 hypothetical protein -
  R2H34_RS04030 - 831356..832012 (-) 657 WP_318342452.1 hypothetical protein -
  R2H34_RS04035 - 832586..833137 (+) 552 WP_270900474.1 hypothetical protein -
  R2H34_RS04040 - 833192..833542 (-) 351 WP_031982463.1 hypothetical protein -
  R2H34_RS04045 - 833626..833820 (+) 195 WP_031982464.1 ribbon-helix-helix protein, CopG family -
  R2H34_RS04050 - 833834..834079 (+) 246 WP_057061227.1 hypothetical protein -
  R2H34_RS04055 - 834084..834263 (+) 180 WP_031982467.1 hypothetical protein -
  R2H34_RS04060 - 834279..836999 (+) 2721 WP_318342453.1 toprim domain-containing protein -
  R2H34_RS04065 - 837070..837507 (+) 438 WP_318342454.1 DUF2528 family protein -
  R2H34_RS04070 - 837504..837728 (+) 225 WP_279957662.1 hypothetical protein -
  R2H34_RS04075 - 837731..838234 (+) 504 WP_279957663.1 hypothetical protein -
  R2H34_RS04080 - 838238..838720 (+) 483 WP_279957664.1 hypothetical protein -
  R2H34_RS04085 - 838724..839035 (+) 312 WP_208476793.1 hypothetical protein -
  R2H34_RS04090 - 839028..839228 (+) 201 WP_279990717.1 hypothetical protein -
  R2H34_RS04095 ssb 839225..839578 (+) 354 WP_053469834.1 single-stranded DNA-binding protein Machinery gene
  R2H34_RS04100 - 839589..840317 (+) 729 WP_318342455.1 3'-5' exonuclease -
  R2H34_RS04105 - 840412..841572 (+) 1161 WP_057061221.1 tyrosine-type recombinase/integrase -
  R2H34_RS04115 - 842248..842715 (+) 468 WP_042892287.1 DMT family transporter -
  R2H34_RS04120 - 842829..843464 (+) 636 WP_042892286.1 nuclease-related domain-containing protein -
  R2H34_RS04125 - 843720..845597 (-) 1878 WP_042892284.1 Mu transposase C-terminal domain-containing protein -
  R2H34_RS04130 - 845599..846306 (-) 708 WP_042892283.1 hypothetical protein -
  R2H34_RS04135 - 846560..846838 (-) 279 WP_171133397.1 hypothetical protein -
  R2H34_RS04140 - 846985..847953 (+) 969 WP_052417826.1 hypothetical protein -
  R2H34_RS04145 - 848116..849399 (-) 1284 WP_042892281.1 ribonucleotide-diphosphate reductase subunit beta -
  R2H34_RS04150 - 849441..849905 (-) 465 WP_004682967.1 hypothetical protein -
  R2H34_RS04155 - 849930..850058 (-) 129 WP_004799830.1 hypothetical protein -
  R2H34_RS04160 - 850121..852955 (-) 2835 WP_087539977.1 ribonucleoside-diphosphate reductase subunit alpha -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13205.89 Da        Isoelectric Point: 9.7119

>NTDB_id=900497 R2H34_RS04095 WP_053469834.1 839225..839578(+) (ssb) [Acinetobacter sp. 16]
MRGINKVILVGSLGANPIAKHFPNGSGYAQFSIATSERWQDKQTGEYRENTEWHRIVAHGRLGEIACQYLKKGSKVYIEG
SLHTRKWTDQNRQENYITEVKVHNLQALDSAPIASPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=900497 R2H34_RS04095 WP_053469834.1 839225..839578(+) (ssb) [Acinetobacter sp. 16]
ATGAGAGGAATCAATAAAGTTATCCTGGTCGGATCACTCGGCGCAAATCCCATTGCTAAGCATTTCCCGAACGGCAGCGG
TTACGCGCAATTTTCAATTGCAACCAGTGAACGTTGGCAAGATAAACAAACGGGTGAATATCGTGAAAATACCGAATGGC
ACCGCATCGTAGCACATGGCCGTTTGGGTGAAATTGCATGTCAATACCTTAAAAAAGGCTCAAAAGTATATATCGAAGGT
TCATTACACACACGTAAATGGACAGATCAAAACCGACAAGAAAACTACATCACGGAAGTGAAGGTTCATAACCTTCAAGC
ACTCGATAGTGCTCCGATCGCAAGTCCAGTGTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

60

94.017

0.564
  ssb Vibrio cholerae strain A1552

54.206

91.453

0.496
  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385
  ssb Neisseria meningitidis MC58

42.857

89.744

0.385
  ssbB/cilA Streptococcus pneumoniae TIGR4

40.566

90.598

0.368