NTDB

Overview

Name	comA/nlmT	Type	Regulator
Locus tag	R4705_RS07840	Genome accession	NZ_CP137115
Coordinates	1490549..1490989 (-)	Length	146 a.a.
NCBI ID	WP_001808911.1	Uniprot ID	-
Organism	Streptococcus pneumoniae strain 20614-6
Function	transport of ComC (predicted from homology) Competence regulation

Genomic Context

Location: 1485549..1495989

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4705_RS07810	-	1486017..1486355 (+)	339	WP_000682119.1	LytTR family DNA-binding domain-containing protein	-
R4705_RS07815	comE/blpR	1486360..1487097 (+)	738	WP_001219127.1	response regulator transcription factor	Regulator
R4705_RS07820	-	1487111..1488451 (+)	1341	WP_001017622.1	sensor histidine kinase	-
R4705_RS07825	blpC	1488493..1488648 (-)	156	WP_000358813.1	quorum-sensing system pheromone BlpC	-
R4705_RS07830	-	1488705..1490066 (-)	1362	WP_001069092.1	bacteriocin secretion accessory protein	-
R4705_RS07835	comA/nlmT	1490077..1490565 (-)	489	WP_307774349.1	ATP-binding cassette domain-containing protein	Regulator
R4705_RS07840	comA/nlmT	1490549..1490989 (-)	441	WP_001808911.1	ATP-binding cassette domain-containing protein	Regulator
R4705_RS07845	comA/nlmT	1490979..1491704 (-)	726	WP_167750760.1	ABC transporter transmembrane domain-containing protein	Regulator
R4705_RS07850	comA/nlmT	1491649..1492236 (-)	588	WP_000205166.1	cysteine peptidase family C39 domain-containing protein	Regulator
R4705_RS07855	blpI	1492518..1492715 (+)	198	WP_001093259.1	bacteriocin-like peptide BlpI	-
R4705_RS07860	cipB	1493182..1493331 (+)	150	WP_001808912.1	bacteriocin-like peptide BlpO	Regulator
R4705_RS07865	-	1493435..1493554 (+)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
R4705_RS07870	-	1494340..1494723 (+)	384	WP_000877381.1	hypothetical protein	-
R4705_RS07875	-	1494775..1495464 (+)	690	WP_000760526.1	CPBP family intramembrane glutamic endopeptidase	-
R4705_RS07880	blpZ	1495506..1495754 (+)	249	WP_000276499.1	immunity protein BlpZ	-

Sequence

Protein

Download Length: 146 a.a. Molecular weight: 16438.75 Da Isoelectric Point: 6.8794

                                >NTDB_id=896286 R4705_RS07840 WP_001808911.1 1490549..1490989(-) (comA/nlmT) [Streptococcus pneumoniae strain 20614-6]

MSSKISIGQLITFNTLLSYFTTPMENIINLQTKLQSAKVANNRLNEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYG

FGRDTLTDINLTIKQGDKVSLVGVSGSGKTTLAKMIVNFFEPYKGHISINHQDIKNIDKKSLAPSY

Nucleotide

Download Length: 441 bp

                                >NTDB_id=896286 R4705_RS07840 WP_001808911.1 1490549..1490989(-) (comA/nlmT) [Streptococcus pneumoniae strain 20614-6]

ATGTCGAGTAAAATTTCTATCGGTCAGCTGATTACCTTTAACACACTTCTTTCTTACTTTACAACTCCTATGGAAAATAT

TATCAACCTCCAAACCAAACTCCAATCTGCGAAGGTCGCTAATAACCGTTTGAACGAAGTCTATCTAGTCGAATCTGAAT

TTCAAGTTCAAGAAAACCCTGTTCATTCACATTTTTTGATGGGCGATATTGAATTTGATGACCTTTCTTATAAGTATGGT

TTTGGACGAGATACCTTAACAGATATTAATCTCACGATTAAACAAGGAGATAAGGTTAGCCTAGTTGGAGTTAGTGGTTC

TGGTAAAACAACTTTAGCCAAAATGATTGTCAATTTCTTTGAACCCTACAAAGGGCATATTTCCATCAATCATCAGGATA

TTAAAAACATTGATAAAAAAAGTCTTGCGCCGTCATATTAA

Domains

Predicted by InterproScan.

ABC transporter (ABC_tran)

(86-142)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comA/nlmT	Streptococcus mutans UA159	71.127	97.26	0.692
comA	Streptococcus mitis NCTC 12261	63.38	97.26	0.616
comA	Streptococcus pneumoniae TIGR4	61.972	97.26	0.603
comA	Streptococcus pneumoniae Rx1	61.972	97.26	0.603
comA	Streptococcus pneumoniae D39	61.972	97.26	0.603
comA	Streptococcus pneumoniae R6	61.972	97.26	0.603
comA	Streptococcus mitis SK321	61.972	97.26	0.603
comA	Streptococcus gordonii str. Challis substr. CH1	59.028	98.63	0.582

Detailed information NTG0896286