Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | R4711_RS05595 | Genome accession | NZ_CP137107 |
| Coordinates | 1097327..1097452 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain 15H4024 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1092327..1102452
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4711_RS05570 | dnaA | 1092812..1094173 (-) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
| R4711_RS05575 | spo0J | 1094386..1095144 (-) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| R4711_RS05580 | htrA | 1095202..1096383 (-) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| R4711_RS05585 | rlmH | 1096566..1097045 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R4711_RS05595 | comC/comC2 | 1097327..1097452 (+) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| R4711_RS05600 | comD/comD2 | 1097473..1098798 (+) | 1326 | WP_000364846.1 | competence system sensor histidine kinase ComD | Regulator |
| R4711_RS05605 | comE | 1098795..1099547 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R4711_RS05620 | - | 1099790..1100332 (-) | 543 | WP_001863823.1 | TetR/AcrR family transcriptional regulator | - |
| R4711_RS05625 | - | 1100511..1102219 (+) | 1709 | Protein_1110 | YhgE/Pip family protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=895631 R4711_RS05595 WP_000799686.1 1097327..1097452(+) (comC/comC2) [Streptococcus pneumoniae strain 15H4024]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=895631 R4711_RS05595 WP_000799686.1 1097327..1097452(+) (comC/comC2) [Streptococcus pneumoniae strain 15H4024]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |