Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | R4710_RS05815 | Genome accession | NZ_CP137101 |
| Coordinates | 1096405..1096641 (+) | Length | 78 a.a. |
| NCBI ID | WP_317804167.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P2012-2 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1086675..1147121 | 1096405..1096641 | within | 0 |
| IScluster/Tn | 1095028..1096087 | 1096405..1096641 | flank | 318 |
Gene organization within MGE regions
Location: 1086675..1147121
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4710_RS05765 | ftsH | 1086675..1088633 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| R4710_RS05770 | comX/comX2 | 1088755..1089234 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| R4710_RS05805 | - | 1094784..1094993 (+) | 210 | Protein_1096 | transposase | - |
| R4710_RS05810 | - | 1095028..1096138 (-) | 1111 | Protein_1097 | transposase | - |
| R4710_RS05815 | comW | 1096405..1096641 (+) | 237 | WP_317804167.1 | sigma(X)-activator ComW | Regulator |
| R4710_RS05820 | - | 1096872..1098158 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| R4710_RS05825 | - | 1098400..1099548 (-) | 1149 | WP_000876727.1 | site-specific integrase | - |
| R4710_RS05830 | - | 1099737..1100660 (-) | 924 | WP_000122589.1 | exonuclease domain-containing protein | - |
| R4710_RS05835 | - | 1100673..1101056 (-) | 384 | WP_000136455.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R4710_RS05840 | - | 1101069..1101431 (-) | 363 | WP_000466344.1 | helix-turn-helix domain-containing protein | - |
| R4710_RS05845 | - | 1101809..1102030 (-) | 222 | WP_000041097.1 | hypothetical protein | - |
| R4710_RS05850 | - | 1102149..1102295 (+) | 147 | WP_000389576.1 | hypothetical protein | - |
| R4710_RS05855 | - | 1102307..1102510 (+) | 204 | WP_000032094.1 | helix-turn-helix domain-containing protein | - |
| R4710_RS05860 | - | 1102653..1103369 (+) | 717 | WP_001002350.1 | ORF6C domain-containing protein | - |
| R4710_RS05865 | - | 1103382..1103639 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| R4710_RS05870 | - | 1103725..1104045 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| R4710_RS05875 | - | 1104061..1104360 (+) | 300 | WP_000391804.1 | hypothetical protein | - |
| R4710_RS05880 | - | 1104351..1105139 (+) | 789 | WP_001185498.1 | phage replisome organizer N-terminal domain-containing protein | - |
| R4710_RS05885 | - | 1105127..1105285 (+) | 159 | WP_000511766.1 | hypothetical protein | - |
| R4710_RS05890 | - | 1105279..1106049 (+) | 771 | WP_000228203.1 | ATP-binding protein | - |
| R4710_RS05895 | - | 1106064..1106258 (+) | 195 | WP_000470343.1 | hypothetical protein | - |
| R4710_RS05900 | - | 1106258..1106485 (+) | 228 | WP_000891972.1 | hypothetical protein | - |
| R4710_RS05905 | - | 1106612..1106776 (+) | 165 | WP_000233201.1 | hypothetical protein | - |
| R4710_RS05910 | - | 1106766..1106975 (+) | 210 | WP_001105098.1 | hypothetical protein | - |
| R4710_RS05915 | - | 1106947..1107264 (+) | 318 | Protein_1118 | hypothetical protein | - |
| R4710_RS05920 | - | 1107266..1107580 (+) | 315 | WP_317804189.1 | hypothetical protein | - |
| R4710_RS05925 | - | 1107531..1107995 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| R4710_RS05930 | - | 1108104..1108646 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| R4710_RS05935 | - | 1109187..1109393 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| R4710_RS05940 | - | 1109530..1110015 (+) | 486 | WP_000601030.1 | hypothetical protein | - |
| R4710_RS05945 | - | 1110008..1111720 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| R4710_RS05950 | - | 1111729..1112871 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| R4710_RS05955 | - | 1112918..1113460 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| R4710_RS05960 | - | 1113475..1114728 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| R4710_RS05965 | - | 1114754..1115089 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| R4710_RS05970 | - | 1115086..1115391 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| R4710_RS05975 | - | 1115391..1115738 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| R4710_RS05980 | - | 1115725..1116069 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| R4710_RS05985 | - | 1116083..1116751 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| R4710_RS05990 | - | 1116753..1117229 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| R4710_RS05995 | - | 1117416..1120154 (+) | 2739 | WP_000852167.1 | phage tail tape measure protein | - |
| R4710_RS06000 | - | 1120151..1120873 (+) | 723 | WP_000161553.1 | phage tail protein | - |
| R4710_RS11250 | - | 1120964..1121776 (+) | 813 | Protein_1136 | phage tail spike protein | - |
| R4710_RS06005 | - | 1123754..1129990 (+) | 6237 | WP_404969406.1 | tail fiber domain-containing protein | - |
| R4710_RS06010 | - | 1129987..1130103 (+) | 117 | Protein_1138 | dihydrodipicolinate reductase | - |
| R4710_RS06015 | - | 1130084..1130287 (+) | 204 | WP_001091107.1 | hypothetical protein | - |
| R4710_RS06020 | - | 1130290..1130640 (+) | 351 | WP_000852249.1 | hypothetical protein | - |
| R4710_RS06025 | - | 1130650..1131066 (+) | 417 | WP_001165344.1 | phage holin family protein | - |
| R4710_RS06030 | - | 1131070..1131402 (+) | 333 | WP_001186229.1 | phage holin | - |
| R4710_RS06035 | - | 1131406..1132362 (+) | 957 | WP_000350504.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| R4710_RS06040 | - | 1132500..1132679 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| R4710_RS06045 | - | 1132821..1132970 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| R4710_RS06050 | tadA | 1133251..1133718 (+) | 468 | WP_000291874.1 | tRNA adenosine(34) deaminase TadA | - |
| R4710_RS06060 | - | 1133905..1134348 (+) | 444 | WP_000701993.1 | dUTP diphosphatase | - |
| R4710_RS06065 | - | 1134350..1134865 (+) | 516 | WP_000691237.1 | histidine phosphatase family protein | - |
| R4710_RS06070 | radA | 1134879..1136240 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| R4710_RS06075 | - | 1136313..1136810 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| R4710_RS06080 | - | 1136835..1137635 (+) | 801 | WP_061630116.1 | PrsW family intramembrane metalloprotease | - |
| R4710_RS06085 | - | 1137780..1138748 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| R4710_RS06090 | - | 1138885..1139163 (-) | 279 | Protein_1153 | transposase family protein | - |
| R4710_RS06095 | - | 1139292..1140202 (-) | 911 | Protein_1154 | Rpn family recombination-promoting nuclease/putative transposase | - |
| R4710_RS06100 | polA | 1140455..1143088 (+) | 2634 | WP_061710694.1 | DNA polymerase I | - |
| R4710_RS06105 | - | 1143173..1143610 (+) | 438 | WP_061636063.1 | CoA-binding protein | - |
| R4710_RS06110 | - | 1144026..1145036 (-) | 1011 | WP_317804243.1 | YeiH family protein | - |
| R4710_RS06115 | - | 1145185..1146354 (+) | 1170 | WP_317804245.1 | pyridoxal phosphate-dependent aminotransferase | - |
| R4710_RS06120 | recO | 1146351..1147121 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9594.04 Da Isoelectric Point: 6.4701
>NTDB_id=895196 R4710_RS05815 WP_317804167.1 1096405..1096641(+) (comW) [Streptococcus pneumoniae strain 16P2012-2]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDLEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDLEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=895196 R4710_RS05815 WP_317804167.1 1096405..1096641(+) (comW) [Streptococcus pneumoniae strain 16P2012-2]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTTGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTTGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
96.154 |
100 |
0.962 |
| comW | Streptococcus pneumoniae D39 |
96.154 |
100 |
0.962 |
| comW | Streptococcus pneumoniae R6 |
96.154 |
100 |
0.962 |
| comW | Streptococcus pneumoniae TIGR4 |
96.154 |
100 |
0.962 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |