Detailed information
Overview
| Name | comE | Type | Machinery gene |
| Locus tag | RRV97_RS09875 | Genome accession | NZ_CP135440 |
| Coordinates | 2094135..2094431 (+) | Length | 98 a.a. |
| NCBI ID | WP_315611429.1 | Uniprot ID | A0AA96NBE6 |
| Organism | Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2061168..2095102 | 2094135..2094431 | within | 0 |
Gene organization within MGE regions
Location: 2061168..2095102
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RRV97_RS09620 (RRV97_09620) | - | 2061168..2061743 (-) | 576 | WP_315611393.1 | YmfQ family protein | - |
| RRV97_RS09625 (RRV97_09625) | - | 2061748..2062800 (-) | 1053 | WP_315611394.1 | baseplate J/gp47 family protein | - |
| RRV97_RS09630 (RRV97_09630) | - | 2062814..2063161 (-) | 348 | WP_315611395.1 | phage GP46 family protein | - |
| RRV97_RS09635 (RRV97_09635) | - | 2063279..2063941 (-) | 663 | WP_315611396.1 | phage baseplate assembly protein V | - |
| RRV97_RS09640 (RRV97_09640) | - | 2063938..2065146 (-) | 1209 | WP_315611397.1 | phage baseplate assembly protein | - |
| RRV97_RS09645 (RRV97_09645) | - | 2065136..2066467 (-) | 1332 | WP_315611398.1 | DNA circularization protein | - |
| RRV97_RS09650 (RRV97_09650) | - | 2066464..2068533 (-) | 2070 | WP_410505873.1 | phage tail tape measure protein | - |
| RRV97_RS09655 (RRV97_09655) | - | 2068872..2069036 (-) | 165 | WP_315612268.1 | hypothetical protein | - |
| RRV97_RS09660 (RRV97_09660) | - | 2069033..2069434 (-) | 402 | WP_315611400.1 | hypothetical protein | - |
| RRV97_RS09665 (RRV97_09665) | - | 2069438..2069815 (-) | 378 | WP_315611401.1 | phage tail protein | - |
| RRV97_RS09670 (RRV97_09670) | - | 2069878..2071293 (-) | 1416 | WP_315611402.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| RRV97_RS09675 (RRV97_09675) | - | 2071293..2071487 (-) | 195 | WP_315611403.1 | DUF2635 domain-containing protein | - |
| RRV97_RS09680 (RRV97_09680) | - | 2071474..2072127 (-) | 654 | WP_315611404.1 | phage protein Gp37 | - |
| RRV97_RS09685 (RRV97_09685) | - | 2072111..2072539 (-) | 429 | WP_315611405.1 | gp436 family protein | - |
| RRV97_RS09690 (RRV97_09690) | - | 2072539..2072910 (-) | 372 | WP_315611406.1 | hypothetical protein | - |
| RRV97_RS09695 (RRV97_09695) | - | 2072972..2073880 (-) | 909 | WP_315611407.1 | Mu-like prophage major head subunit gpT family protein | - |
| RRV97_RS09700 (RRV97_09700) | - | 2073880..2074950 (-) | 1071 | WP_315612260.1 | phage protease | - |
| RRV97_RS09705 (RRV97_09705) | - | 2075181..2075594 (-) | 414 | WP_315611408.1 | phage virion morphogenesis protein | - |
| RRV97_RS09710 (RRV97_09710) | - | 2075704..2076993 (-) | 1290 | WP_315611409.1 | phage minor head protein | - |
| RRV97_RS09715 (RRV97_09715) | - | 2076980..2078536 (-) | 1557 | WP_315611410.1 | DUF935 domain-containing protein | - |
| RRV97_RS09720 (RRV97_09720) | terL | 2078536..2080176 (-) | 1641 | WP_315611411.1 | phage terminase large subunit | - |
| RRV97_RS09725 (RRV97_09725) | - | 2080181..2081002 (-) | 822 | WP_315611412.1 | DNA (cytosine-5-)-methyltransferase | - |
| RRV97_RS09730 (RRV97_09730) | - | 2080995..2081501 (-) | 507 | WP_004520456.1 | DUF1804 family protein | - |
| RRV97_RS09735 (RRV97_09735) | - | 2081504..2081701 (-) | 198 | WP_004520457.1 | hypothetical protein | - |
| RRV97_RS09740 (RRV97_09740) | - | 2081698..2081964 (-) | 267 | WP_004520458.1 | hypothetical protein | - |
| RRV97_RS09745 (RRV97_09745) | - | 2081976..2082305 (-) | 330 | WP_070823971.1 | hypothetical protein | - |
| RRV97_RS09750 (RRV97_09750) | - | 2082302..2082619 (-) | 318 | WP_315611413.1 | hypothetical protein | - |
| RRV97_RS09755 (RRV97_09755) | - | 2082516..2082935 (-) | 420 | WP_254321199.1 | hypothetical protein | - |
| RRV97_RS09760 (RRV97_09760) | - | 2082907..2083143 (-) | 237 | WP_049343846.1 | hypothetical protein | - |
| RRV97_RS09765 (RRV97_09765) | - | 2083312..2083485 (-) | 174 | WP_002245587.1 | hypothetical protein | - |
| RRV97_RS09770 (RRV97_09770) | - | 2083482..2084027 (-) | 546 | WP_315611414.1 | N-acetylmuramoyl-L-alanine amidase | - |
| RRV97_RS09775 (RRV97_09775) | - | 2084174..2084611 (-) | 438 | WP_315611415.1 | Mor transcription activator family protein | - |
| RRV97_RS09780 (RRV97_09780) | - | 2084614..2085018 (-) | 405 | WP_315611416.1 | gp16 family protein | - |
| RRV97_RS09785 (RRV97_09785) | - | 2085168..2085764 (-) | 597 | WP_315611417.1 | hypothetical protein | - |
| RRV97_RS09790 (RRV97_09790) | - | 2085779..2085958 (-) | 180 | WP_082815512.1 | hypothetical protein | - |
| RRV97_RS09795 (RRV97_09795) | - | 2086077..2086286 (-) | 210 | WP_315611418.1 | hypothetical protein | - |
| RRV97_RS09800 (RRV97_09800) | - | 2086283..2086468 (-) | 186 | WP_315611419.1 | hypothetical protein | - |
| RRV97_RS09805 (RRV97_09805) | - | 2086468..2086989 (-) | 522 | WP_315611420.1 | host-nuclease inhibitor Gam family protein | - |
| RRV97_RS09810 (RRV97_09810) | - | 2086982..2087128 (-) | 147 | WP_168162674.1 | hypothetical protein | - |
| RRV97_RS09815 (RRV97_09815) | - | 2087140..2087340 (-) | 201 | WP_315611421.1 | hypothetical protein | - |
| RRV97_RS09820 (RRV97_09820) | - | 2087356..2087601 (-) | 246 | WP_315611422.1 | hypothetical protein | - |
| RRV97_RS09825 (RRV97_09825) | - | 2087603..2088430 (-) | 828 | WP_315611423.1 | hypothetical protein | - |
| RRV97_RS09830 (RRV97_09830) | - | 2088427..2088867 (-) | 441 | WP_315611424.1 | hypothetical protein | - |
| RRV97_RS09835 (RRV97_09835) | - | 2088867..2089034 (-) | 168 | WP_004520475.1 | hypothetical protein | - |
| RRV97_RS09840 (RRV97_09840) | - | 2089106..2089228 (-) | 123 | WP_256388733.1 | hypothetical protein | - |
| RRV97_RS09845 (RRV97_09845) | - | 2089225..2089383 (-) | 159 | WP_315611425.1 | hypothetical protein | - |
| RRV97_RS09850 (RRV97_09850) | - | 2089489..2089728 (-) | 240 | WP_049336928.1 | hypothetical protein | - |
| RRV97_RS09855 (RRV97_09855) | - | 2089806..2090702 (-) | 897 | WP_315611426.1 | AAA family ATPase | - |
| RRV97_RS09860 (RRV97_09860) | - | 2090720..2092747 (-) | 2028 | WP_315611427.1 | Mu transposase C-terminal domain-containing protein | - |
| RRV97_RS09865 (RRV97_09865) | - | 2092791..2093054 (-) | 264 | WP_079453753.1 | helix-turn-helix domain-containing protein | - |
| RRV97_RS09870 (RRV97_09870) | - | 2093257..2093970 (+) | 714 | WP_315611428.1 | helix-turn-helix transcriptional regulator | - |
| RRV97_RS09875 (RRV97_09875) | comE | 2094135..2094431 (+) | 297 | WP_315611429.1 | ComEA family DNA-binding protein | Machinery gene |
| RRV97_RS09880 (RRV97_09880) | comP | 2094608..2095102 (+) | 495 | WP_315611430.1 | type IV pilin protein | Machinery gene |
Sequence
Protein
Download Length: 98 a.a. Molecular weight: 9996.69 Da Isoelectric Point: 10.3874
>NTDB_id=886649 RRV97_RS09875 WP_315611429.1 2094135..2094431(+) (comE) [Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055]
MQKLTVPHIGVVAAVCTAFSLAAVNVNTASSAELEALPGIGPAKAKAIVEYRQKNGAFKSVEELKNVKGIGDAVLNKLKA
EATVSSAAPKAAQPAVKK
MQKLTVPHIGVVAAVCTAFSLAAVNVNTASSAELEALPGIGPAKAKAIVEYRQKNGAFKSVEELKNVKGIGDAVLNKLKA
EATVSSAAPKAAQPAVKK
Nucleotide
Download Length: 297 bp
>NTDB_id=886649 RRV97_RS09875 WP_315611429.1 2094135..2094431(+) (comE) [Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055]
GTGCAAAAACTAACAGTCCCCCACATTGGTGTAGTTGCCGCCGTTTGTACGGCGTTCTCTTTGGCTGCCGTGAACGTCAA
TACGGCCTCTTCTGCGGAACTGGAGGCATTGCCGGGTATCGGCCCGGCTAAGGCGAAGGCGATTGTGGAATACCGTCAGA
AGAACGGTGCGTTCAAATCGGTGGAGGAGCTGAAAAACGTGAAGGGCATCGGTGATGCGGTGCTGAACAAGTTGAAGGCG
GAGGCGACGGTTTCTTCTGCCGCGCCTAAGGCCGCCCAACCTGCCGTGAAAAAATAA
GTGCAAAAACTAACAGTCCCCCACATTGGTGTAGTTGCCGCCGTTTGTACGGCGTTCTCTTTGGCTGCCGTGAACGTCAA
TACGGCCTCTTCTGCGGAACTGGAGGCATTGCCGGGTATCGGCCCGGCTAAGGCGAAGGCGATTGTGGAATACCGTCAGA
AGAACGGTGCGTTCAAATCGGTGGAGGAGCTGAAAAACGTGAAGGGCATCGGTGATGCGGTGCTGAACAAGTTGAAGGCG
GAGGCGACGGTTTCTTCTGCCGCGCCTAAGGCCGCCCAACCTGCCGTGAAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Neisseria gonorrhoeae MS11 |
68.605 |
87.755 |
0.602 |
| comE | Neisseria gonorrhoeae MS11 |
68.605 |
87.755 |
0.602 |
| comE | Neisseria gonorrhoeae MS11 |
68.605 |
87.755 |
0.602 |
| comE | Neisseria gonorrhoeae MS11 |
68.605 |
87.755 |
0.602 |
| Cj0011c | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
48.81 |
85.714 |
0.418 |
| comEA | Staphylococcus aureus MW2 |
47.059 |
86.735 |
0.408 |