Detailed information    

insolico Bioinformatically predicted

Overview

Name   comP   Type   Machinery gene
Locus tag   RRV97_RS09880 Genome accession   NZ_CP135440
Coordinates   2094608..2095102 (+) Length   164 a.a.
NCBI ID   WP_315611430.1    Uniprot ID   A0AA96NAX6
Organism   Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2061168..2095102 2094608..2095102 within 0


Gene organization within MGE regions


Location: 2061168..2095102
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RRV97_RS09620 (RRV97_09620) - 2061168..2061743 (-) 576 WP_315611393.1 YmfQ family protein -
  RRV97_RS09625 (RRV97_09625) - 2061748..2062800 (-) 1053 WP_315611394.1 baseplate J/gp47 family protein -
  RRV97_RS09630 (RRV97_09630) - 2062814..2063161 (-) 348 WP_315611395.1 phage GP46 family protein -
  RRV97_RS09635 (RRV97_09635) - 2063279..2063941 (-) 663 WP_315611396.1 phage baseplate assembly protein V -
  RRV97_RS09640 (RRV97_09640) - 2063938..2065146 (-) 1209 WP_315611397.1 phage baseplate assembly protein -
  RRV97_RS09645 (RRV97_09645) - 2065136..2066467 (-) 1332 WP_315611398.1 DNA circularization protein -
  RRV97_RS09650 (RRV97_09650) - 2066464..2068533 (-) 2070 WP_410505873.1 phage tail tape measure protein -
  RRV97_RS09655 (RRV97_09655) - 2068872..2069036 (-) 165 WP_315612268.1 hypothetical protein -
  RRV97_RS09660 (RRV97_09660) - 2069033..2069434 (-) 402 WP_315611400.1 hypothetical protein -
  RRV97_RS09665 (RRV97_09665) - 2069438..2069815 (-) 378 WP_315611401.1 phage tail protein -
  RRV97_RS09670 (RRV97_09670) - 2069878..2071293 (-) 1416 WP_315611402.1 phage tail sheath subtilisin-like domain-containing protein -
  RRV97_RS09675 (RRV97_09675) - 2071293..2071487 (-) 195 WP_315611403.1 DUF2635 domain-containing protein -
  RRV97_RS09680 (RRV97_09680) - 2071474..2072127 (-) 654 WP_315611404.1 phage protein Gp37 -
  RRV97_RS09685 (RRV97_09685) - 2072111..2072539 (-) 429 WP_315611405.1 gp436 family protein -
  RRV97_RS09690 (RRV97_09690) - 2072539..2072910 (-) 372 WP_315611406.1 hypothetical protein -
  RRV97_RS09695 (RRV97_09695) - 2072972..2073880 (-) 909 WP_315611407.1 Mu-like prophage major head subunit gpT family protein -
  RRV97_RS09700 (RRV97_09700) - 2073880..2074950 (-) 1071 WP_315612260.1 phage protease -
  RRV97_RS09705 (RRV97_09705) - 2075181..2075594 (-) 414 WP_315611408.1 phage virion morphogenesis protein -
  RRV97_RS09710 (RRV97_09710) - 2075704..2076993 (-) 1290 WP_315611409.1 phage minor head protein -
  RRV97_RS09715 (RRV97_09715) - 2076980..2078536 (-) 1557 WP_315611410.1 DUF935 domain-containing protein -
  RRV97_RS09720 (RRV97_09720) terL 2078536..2080176 (-) 1641 WP_315611411.1 phage terminase large subunit -
  RRV97_RS09725 (RRV97_09725) - 2080181..2081002 (-) 822 WP_315611412.1 DNA (cytosine-5-)-methyltransferase -
  RRV97_RS09730 (RRV97_09730) - 2080995..2081501 (-) 507 WP_004520456.1 DUF1804 family protein -
  RRV97_RS09735 (RRV97_09735) - 2081504..2081701 (-) 198 WP_004520457.1 hypothetical protein -
  RRV97_RS09740 (RRV97_09740) - 2081698..2081964 (-) 267 WP_004520458.1 hypothetical protein -
  RRV97_RS09745 (RRV97_09745) - 2081976..2082305 (-) 330 WP_070823971.1 hypothetical protein -
  RRV97_RS09750 (RRV97_09750) - 2082302..2082619 (-) 318 WP_315611413.1 hypothetical protein -
  RRV97_RS09755 (RRV97_09755) - 2082516..2082935 (-) 420 WP_254321199.1 hypothetical protein -
  RRV97_RS09760 (RRV97_09760) - 2082907..2083143 (-) 237 WP_049343846.1 hypothetical protein -
  RRV97_RS09765 (RRV97_09765) - 2083312..2083485 (-) 174 WP_002245587.1 hypothetical protein -
  RRV97_RS09770 (RRV97_09770) - 2083482..2084027 (-) 546 WP_315611414.1 N-acetylmuramoyl-L-alanine amidase -
  RRV97_RS09775 (RRV97_09775) - 2084174..2084611 (-) 438 WP_315611415.1 Mor transcription activator family protein -
  RRV97_RS09780 (RRV97_09780) - 2084614..2085018 (-) 405 WP_315611416.1 gp16 family protein -
  RRV97_RS09785 (RRV97_09785) - 2085168..2085764 (-) 597 WP_315611417.1 hypothetical protein -
  RRV97_RS09790 (RRV97_09790) - 2085779..2085958 (-) 180 WP_082815512.1 hypothetical protein -
  RRV97_RS09795 (RRV97_09795) - 2086077..2086286 (-) 210 WP_315611418.1 hypothetical protein -
  RRV97_RS09800 (RRV97_09800) - 2086283..2086468 (-) 186 WP_315611419.1 hypothetical protein -
  RRV97_RS09805 (RRV97_09805) - 2086468..2086989 (-) 522 WP_315611420.1 host-nuclease inhibitor Gam family protein -
  RRV97_RS09810 (RRV97_09810) - 2086982..2087128 (-) 147 WP_168162674.1 hypothetical protein -
  RRV97_RS09815 (RRV97_09815) - 2087140..2087340 (-) 201 WP_315611421.1 hypothetical protein -
  RRV97_RS09820 (RRV97_09820) - 2087356..2087601 (-) 246 WP_315611422.1 hypothetical protein -
  RRV97_RS09825 (RRV97_09825) - 2087603..2088430 (-) 828 WP_315611423.1 hypothetical protein -
  RRV97_RS09830 (RRV97_09830) - 2088427..2088867 (-) 441 WP_315611424.1 hypothetical protein -
  RRV97_RS09835 (RRV97_09835) - 2088867..2089034 (-) 168 WP_004520475.1 hypothetical protein -
  RRV97_RS09840 (RRV97_09840) - 2089106..2089228 (-) 123 WP_256388733.1 hypothetical protein -
  RRV97_RS09845 (RRV97_09845) - 2089225..2089383 (-) 159 WP_315611425.1 hypothetical protein -
  RRV97_RS09850 (RRV97_09850) - 2089489..2089728 (-) 240 WP_049336928.1 hypothetical protein -
  RRV97_RS09855 (RRV97_09855) - 2089806..2090702 (-) 897 WP_315611426.1 AAA family ATPase -
  RRV97_RS09860 (RRV97_09860) - 2090720..2092747 (-) 2028 WP_315611427.1 Mu transposase C-terminal domain-containing protein -
  RRV97_RS09865 (RRV97_09865) - 2092791..2093054 (-) 264 WP_079453753.1 helix-turn-helix domain-containing protein -
  RRV97_RS09870 (RRV97_09870) - 2093257..2093970 (+) 714 WP_315611428.1 helix-turn-helix transcriptional regulator -
  RRV97_RS09875 (RRV97_09875) comE 2094135..2094431 (+) 297 WP_315611429.1 ComEA family DNA-binding protein Machinery gene
  RRV97_RS09880 (RRV97_09880) comP 2094608..2095102 (+) 495 WP_315611430.1 type IV pilin protein Machinery gene

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 18022.10 Da        Isoelectric Point: 10.0610

>NTDB_id=886650 RRV97_RS09880 WP_315611430.1 2094608..2095102(+) (comP) [Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055]
MYLKAFDGKRNGATVQRGYSLVQLLVVMLLVSILAMTAFTAYRESVRSANLRAAHAALLENARFMEQFYAKKGSFKLTST
KWPELPVKEAGGFCIRMSGQAKGILEGKFTLKAVALDREAEPRVLRLNESLTAVVCGKMKGKGSCTDGEEIFRGNDAECK
PFMG

Nucleotide


Download         Length: 495 bp        

>NTDB_id=886650 RRV97_RS09880 WP_315611430.1 2094608..2095102(+) (comP) [Neisseria sp. DTU_2021_1001991_1_SI_NGA_ILE_055]
ATGTACTTAAAAGCATTTGACGGAAAACGGAATGGAGCAACTGTGCAGAGGGGGTATTCTTTGGTACAGCTGTTGGTGGT
GATGCTGCTGGTTTCGATCTTGGCGATGACGGCCTTTACGGCCTATCGGGAATCGGTCCGCTCGGCCAACCTGCGTGCGG
CGCATGCCGCGCTGCTGGAAAATGCGCGCTTTATGGAGCAGTTCTACGCGAAAAAGGGCAGCTTTAAGCTGACGTCGACG
AAGTGGCCGGAATTGCCGGTGAAGGAGGCGGGCGGTTTCTGTATCAGGATGAGCGGTCAGGCTAAGGGGATTCTGGAGGG
TAAGTTTACCTTGAAGGCGGTGGCGCTGGACAGGGAGGCGGAGCCGAGGGTGCTGCGCTTGAACGAGTCGTTGACGGCGG
TGGTGTGCGGGAAGATGAAGGGGAAGGGCAGTTGTACGGACGGCGAGGAGATATTTAGGGGTAATGATGCGGAGTGTAAG
CCTTTTATGGGGTAA

Domains

Predicted by InterproScan.

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(41-120)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria subflava NJ9703

93.902

100

0.939
  comP Neisseria meningitidis 8013

51.007

90.854

0.463
  comP Neisseria gonorrhoeae MS11

51.02

89.634

0.457