Detailed information NTG0884914

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: RMP65_RS00790
• Genome accession: NZ_CP135089
• Coordinates: 122297..122731 (+)
• Length: 144 a.a.
• NCBI ID: WP_044762030.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID34567
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 117297..127731

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP65_RS00755 (RMP65_00755)	-	118037..118411 (+)	375	WP_024385120.1	DUF1033 family protein	-
RMP65_RS00760 (RMP65_00760)	-	118439..119389 (-)	951	WP_074391326.1	S66 peptidase family protein	-
RMP65_RS00765 (RMP65_00765)	comYA	119475..120425 (+)	951	WP_074391327.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP65_RS00770 (RMP65_00770)	comYB	120337..121374 (+)	1038	WP_269472402.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP65_RS00775 (RMP65_00775)	comYC	121376..121657 (+)	282	WP_074391328.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP65_RS00780 (RMP65_00780)	comGD	121638..122045 (+)	408	WP_074391329.1	competence type IV pilus minor pilin ComGD	-
RMP65_RS00785 (RMP65_00785)	comYE	122017..122310 (+)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP65_RS00790 (RMP65_00790)	comGF/cglF	122297..122731 (+)	435	WP_044762030.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP65_RS00795 (RMP65_00795)	comGG	122709..123122 (+)	414	WP_074391330.1	competence type IV pilus minor pilin ComGG	-
RMP65_RS00800 (RMP65_00800)	comYH	123172..124125 (+)	954	WP_024414316.1	class I SAM-dependent methyltransferase	Machinery gene
RMP65_RS00805 (RMP65_00805)	-	124175..125362 (+)	1188	WP_044680792.1	acetate kinase	-
RMP65_RS00810 (RMP65_00810)	-	125679..126230 (+)	552	WP_044680793.1	folate family ECF transporter S component	-
RMP65_RS00815 (RMP65_00815)	-	126286..127542 (+)	1257	WP_074391333.1	folylpolyglutamate synthase/dihydrofolate synthase family protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16334.63 Da
• Isoelectric Point: 6.9822

>NTDB_id=884914 RMP65_RS00790 WP_044762030.1 122297..122731(+) (comGF/cglF) [Streptococcus suis strain ID34567]
MLKSKIPAFTLLECLVALVILSGSLLVFEGLSKLLVQEAHYQGQTVQKEWLVFSSQLRSEWDQADLVKVENGKVYVDKGG
QALAFGKSRSDDFRKTNDRGQGYQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS

Nucleotide

• Length: 435 bp

>NTDB_id=884914 RMP65_RS00790 WP_044762030.1 122297..122731(+) (comGF/cglF) [Streptococcus suis strain ID34567]
TTGTTAAAAAGTAAAATTCCTGCTTTTACTCTCTTGGAATGCTTGGTAGCCTTAGTCATTCTTTCAGGTAGTCTTCTGGT
CTTTGAAGGCTTGTCAAAACTGCTGGTCCAAGAAGCGCATTATCAAGGTCAGACCGTTCAAAAGGAATGGTTGGTCTTCT
CTAGTCAATTGCGGTCGGAGTGGGATCAGGCTGACTTGGTCAAGGTTGAAAATGGCAAGGTCTATGTTGATAAGGGTGGT
CAGGCTTTGGCCTTTGGTAAGTCACGGTCGGATGATTTTCGGAAAACAAATGACAGGGGACAGGGCTACCAGCCCATGCT
CTATCAGGTGGACAGCGCAGCTATTTCCCAAGAAAACCAGCTGGTGCGCATCGACTTTAGTTTTAAAAACGGAGAGGAGC
GGACCTTTATCTATGCTTTTAAAGAAAAAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (37-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus pneumoniae TIGR4	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae Rx1	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae D39	53.901	97.917	0.528
comGF/cglF	Streptococcus pneumoniae R6	53.901	97.917	0.528
comGF/cglF	Streptococcus mitis NCTC 12261	54.478	93.056	0.507
comYF	Streptococcus mutans UA140	50	100	0.5
comYF	Streptococcus mutans UA159	49.306	100	0.493
comGF/cglF	Streptococcus mitis SK321	51.493	93.056	0.479
comGF	Lactococcus lactis subsp. cremoris KW2	46.809	97.917	0.458