Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RHO15_RS08800 | Genome accession | NZ_CP133959 |
| Coordinates | 1955789..1956280 (+) | Length | 163 a.a. |
| NCBI ID | WP_392565661.1 | Uniprot ID | - |
| Organism | Utexia brackfieldae strain lpD01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1955789..1993846 | 1955789..1956280 | within | 0 |
Gene organization within MGE regions
Location: 1955789..1993846
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RHO15_RS08800 (RHO15_08745) | ssb | 1955789..1956280 (+) | 492 | WP_392565661.1 | single-stranded DNA-binding protein | Machinery gene |
| RHO15_RS08805 (RHO15_08750) | - | 1956455..1957129 (+) | 675 | WP_392565662.1 | MarC family NAAT transporter | - |
| RHO15_RS08810 (RHO15_08755) | - | 1957228..1957920 (-) | 693 | WP_392565663.1 | DUF2461 domain-containing protein | - |
| RHO15_RS08815 (RHO15_08760) | - | 1957985..1958161 (-) | 177 | WP_392565664.1 | Trm112 family protein | - |
| RHO15_RS08820 (RHO15_08765) | lpxK | 1958204..1959193 (-) | 990 | WP_392565665.1 | tetraacyldisaccharide 4'-kinase | - |
| RHO15_RS08825 (RHO15_08770) | msbA | 1959193..1960890 (-) | 1698 | WP_392567107.1 | lipid A ABC transporter ATP-binding protein/permease MsbA | - |
| RHO15_RS08830 (RHO15_08775) | - | 1960990..1963317 (-) | 2328 | WP_392565666.1 | DNA internalization-related competence protein ComEC/Rec2 | - |
| RHO15_RS08835 (RHO15_08780) | - | 1963628..1963915 (-) | 288 | WP_392565667.1 | integration host factor subunit beta | - |
| RHO15_RS08840 (RHO15_08785) | rpsA | 1964004..1965686 (-) | 1683 | WP_392565668.1 | 30S ribosomal protein S1 | - |
| RHO15_RS08845 (RHO15_08790) | cmk | 1965787..1966464 (-) | 678 | WP_392567108.1 | (d)CMP kinase | - |
| RHO15_RS08850 (RHO15_08795) | aroA | 1966514..1967800 (-) | 1287 | WP_392567109.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| RHO15_RS08855 (RHO15_08800) | - | 1968044..1968631 (-) | 588 | WP_392565669.1 | sugar O-acetyltransferase | - |
| RHO15_RS08860 (RHO15_08805) | - | 1968710..1969588 (-) | 879 | WP_392565670.1 | helix-turn-helix domain-containing protein | - |
| RHO15_RS08865 (RHO15_08810) | - | 1970025..1970273 (-) | 249 | WP_392565671.1 | hypothetical protein | - |
| RHO15_RS08875 (RHO15_08820) | dnaQ | 1971169..1971921 (-) | 753 | WP_392565672.1 | DNA polymerase III subunit epsilon | - |
| RHO15_RS08880 (RHO15_08825) | rnhA | 1972012..1972482 (+) | 471 | WP_392567110.1 | ribonuclease HI | - |
| RHO15_RS08885 (RHO15_08830) | gloB | 1972487..1973239 (+) | 753 | WP_392567111.1 | hydroxyacylglutathione hydrolase | - |
| RHO15_RS08890 (RHO15_08835) | - | 1973313..1974542 (+) | 1230 | WP_392565673.1 | transglycosylase SLT domain-containing protein | - |
| RHO15_RS08895 (RHO15_08840) | - | 1974559..1975329 (-) | 771 | WP_392565674.1 | endonuclease/exonuclease/phosphatase family protein | - |
| RHO15_RS08900 (RHO15_08845) | gshA | 1975491..1977050 (-) | 1560 | WP_392565675.1 | glutamate--cysteine ligase | - |
| RHO15_RS08905 (RHO15_08850) | - | 1977182..1977868 (-) | 687 | WP_392565676.1 | aspartate/glutamate racemase family protein | - |
| RHO15_RS08910 (RHO15_08855) | rlmC | 1977880..1979022 (-) | 1143 | WP_392565677.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| RHO15_RS08915 (RHO15_08860) | - | 1979213..1980064 (-) | 852 | WP_392565678.1 | carboxylate/amino acid/amine transporter | - |
| RHO15_RS08920 (RHO15_08865) | - | 1980330..1980539 (-) | 210 | WP_392565679.1 | cold shock domain-containing protein | - |
| RHO15_RS08925 (RHO15_08870) | - | 1980827..1980979 (-) | 153 | WP_392565680.1 | YoaH family protein | - |
| RHO15_RS08930 (RHO15_08875) | - | 1981167..1981373 (-) | 207 | WP_392565681.1 | hypothetical protein | - |
| RHO15_RS08935 (RHO15_08880) | - | 1981897..1982106 (-) | 210 | WP_392565682.1 | cold shock domain-containing protein | - |
| RHO15_RS08940 (RHO15_08885) | - | 1982415..1982681 (-) | 267 | WP_392565683.1 | hypothetical protein | - |
| RHO15_RS08945 (RHO15_08890) | - | 1982857..1983201 (-) | 345 | WP_392565684.1 | tail fiber assembly protein | - |
| RHO15_RS08950 (RHO15_08895) | - | 1983183..1984328 (-) | 1146 | WP_392565685.1 | phage tail protein | - |
| RHO15_RS08955 (RHO15_08900) | - | 1984338..1984544 (-) | 207 | WP_392565686.1 | hypothetical protein | - |
| RHO15_RS08960 (RHO15_08905) | - | 1985260..1986084 (+) | 825 | WP_392565687.1 | hypothetical protein | - |
| RHO15_RS08965 (RHO15_08910) | - | 1986089..1986382 (-) | 294 | WP_392565688.1 | hypothetical protein | - |
| RHO15_RS08970 (RHO15_08915) | - | 1986489..1987058 (+) | 570 | WP_392565689.1 | serine O-acetyltransferase | - |
| RHO15_RS08975 (RHO15_08920) | - | 1987051..1987428 (-) | 378 | WP_392567112.1 | DUF3383 family protein | - |
| RHO15_RS08980 (RHO15_08925) | - | 1987425..1987952 (-) | 528 | WP_392565690.1 | LIC_12616 family protein | - |
| RHO15_RS08985 (RHO15_08930) | - | 1987996..1988295 (-) | 300 | WP_392565691.1 | hypothetical protein | - |
| RHO15_RS08990 (RHO15_08935) | - | 1988699..1988950 (+) | 252 | WP_392565692.1 | hypothetical protein | - |
| RHO15_RS08995 (RHO15_08940) | - | 1989098..1989580 (-) | 483 | WP_392565693.1 | lysis system i-spanin subunit Rz | - |
| RHO15_RS09000 (RHO15_08945) | - | 1989570..1989677 (-) | 108 | WP_392565694.1 | glycoside hydrolase family protein | - |
| RHO15_RS09005 (RHO15_08950) | - | 1989718..1989999 (-) | 282 | WP_392565695.1 | lysozyme | - |
| RHO15_RS09010 (RHO15_08955) | - | 1989996..1990298 (-) | 303 | WP_392565696.1 | phage holin family protein | - |
| RHO15_RS09015 (RHO15_08960) | - | 1990643..1991008 (-) | 366 | WP_392565697.1 | winged helix-turn-helix transcriptional regulator | - |
| RHO15_RS09020 (RHO15_08965) | - | 1991235..1992086 (-) | 852 | WP_392565698.1 | ATP-binding protein | - |
| RHO15_RS09025 (RHO15_08970) | - | 1992086..1992226 (-) | 141 | WP_392565699.1 | hypothetical protein | - |
| RHO15_RS09030 | - | 1992571..1992820 (-) | 250 | Protein_1759 | helix-turn-helix domain-containing protein | - |
| RHO15_RS09035 (RHO15_08975) | - | 1993169..1993846 (+) | 678 | WP_392565700.1 | XRE family transcriptional regulator | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 17638.64 Da Isoelectric Point: 4.9468
>NTDB_id=878026 RHO15_RS08800 WP_392565661.1 1955789..1956280(+) (ssb) [Utexia brackfieldae strain lpD01]
MASRGINKVILVGNLGQDPEVRYLPNGGAVANISIATSESWKDKQTGEQKERTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGALQTRKWQDQSGQDRYSTEVVVNIGGVLQILGSRNAGDAPAPAANQNWGQSANNMSSAPAASQPAPMSKEPPIDFDDD
IPF
MASRGINKVILVGNLGQDPEVRYLPNGGAVANISIATSESWKDKQTGEQKERTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGALQTRKWQDQSGQDRYSTEVVVNIGGVLQILGSRNAGDAPAPAANQNWGQSANNMSSAPAASQPAPMSKEPPIDFDDD
IPF
Nucleotide
Download Length: 492 bp
>NTDB_id=878026 RHO15_RS08800 WP_392565661.1 1955789..1956280(+) (ssb) [Utexia brackfieldae strain lpD01]
ATGGCAAGTCGTGGTATTAATAAAGTTATTCTGGTTGGTAATTTAGGACAAGATCCTGAAGTTCGTTATTTGCCGAATGG
CGGCGCAGTTGCCAATATCAGTATCGCCACTTCAGAATCCTGGAAAGATAAACAGACGGGCGAACAAAAAGAACGAACTG
AATGGCATCGTGTGGTTATTTTCGGCAAACTAGCTGAAATTGCGGGTGAATATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTGCACTGCAAACGCGTAAATGGCAAGATCAAAGTGGTCAGGATCGTTATAGTACCGAAGTTGTCGTTAATATTGG
CGGTGTTTTACAAATTCTTGGTTCACGTAACGCCGGCGATGCACCAGCACCAGCAGCGAATCAAAATTGGGGACAAAGTG
CCAATAATATGTCATCAGCACCCGCTGCTAGCCAACCAGCTCCGATGAGTAAAGAGCCACCAATCGATTTTGATGATGAT
ATACCGTTCTAA
ATGGCAAGTCGTGGTATTAATAAAGTTATTCTGGTTGGTAATTTAGGACAAGATCCTGAAGTTCGTTATTTGCCGAATGG
CGGCGCAGTTGCCAATATCAGTATCGCCACTTCAGAATCCTGGAAAGATAAACAGACGGGCGAACAAAAAGAACGAACTG
AATGGCATCGTGTGGTTATTTTCGGCAAACTAGCTGAAATTGCGGGTGAATATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTGCACTGCAAACGCGTAAATGGCAAGATCAAAGTGGTCAGGATCGTTATAGTACCGAAGTTGTCGTTAATATTGG
CGGTGTTTTACAAATTCTTGGTTCACGTAACGCCGGCGATGCACCAGCACCAGCAGCGAATCAAAATTGGGGACAAAGTG
CCAATAATATGTCATCAGCACCCGCTGCTAGCCAACCAGCTCCGATGAGTAAAGAGCCACCAATCGATTTTGATGATGAT
ATACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
66.102 |
100 |
0.718 |
| ssb | Glaesserella parasuis strain SC1401 |
54.144 |
100 |
0.601 |
| ssb | Neisseria gonorrhoeae MS11 |
44.633 |
100 |
0.485 |
| ssb | Neisseria meningitidis MC58 |
44.633 |
100 |
0.485 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
34.286 |
100 |
0.368 |